Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U325556

Score 
140
Direction 
Reverse
Predicted Peptide Sequence 
MTNTQQKFQFQITQKKIPSASSSIXSHQCLLRPSEYCESGTTSDNGVDIGVGNGEFRQTGHEAFNFSHHLRTSHENNAYTQVTSVTSPLP
CNRTNKSHTRRRFCFRFRFPNFRFCLSKLIWVRVDYCLIEARESVRDETSSFSSSSATKITLGXVNSGVRVSRLGLGLTAAIGSGAAAXG
XDERMRVDRRKRKARAIAIAVAEAYFVEALDELLVVVRGGGGTAVAAEGMVDIGRILREAPLD
Predicted Coding Sequence 
ATGACTAATACTCAACAGAAATTCCAATTTCAAATTACACAAAAGAAAATTCCAAGCGCTTCCTCATCTATTNTCAGTCATCAATGTCTT
CTCCGACCATCGGAATATTGTGAAAGTGGGACCACCTCCGACAACGGCGTGGACATCGGCGTCGGCAACGGCGAGTTCCGGCAGACTGGA
CATGAAGCATTCAATTTCAGCCACCATCTACGCACATCACATGAAAATAATGCTTACACTCAGGTAACATCCGTAACATCTCCGCTTCCT
TGTAATCGCACAAACAAATCGCACACACGACGTCGTTTCTGCTTCCGTTTCCGTTTCCCCAATTTCCGTTTCTGCTTGAGTAAATTAATT
TGGGTAAGAGTTGATTACTGCTTGATTGAGGCCCGCGAAAGTGTTCGAGATGAAACGTCGTCGTTTTCGTCTTCCTCAGCAACGAAAATT
ACACTCGGAXATGTAAATTCCGGTGTTCGGGTTTCGAGACTGGGATTGGGCTTGACGGCGGCGATAGGCAGCGGAGCGGCAGCAXTAGGT
AAXGATGAAAGGATGAGAGTTGATAGGAGGAAGAGGAAGGCAAGGGCAATTGCAATTGCXGTAGCCGAGGCCTATTTTGTTGAGGCTCTC
GATGAGCTATTGGTGGTGGTTAGAGGTGGTGGTGGXACCGCCGTGGCGGCGGAGGGAATGGTGGACATTGGGAGAATACTAAGAGAAGCT
CCATTAGATTAA
Edits in Original Sequence 
AAGATAAAATAAAATATTATTAGATCTAGAAATATATTCTTTCTTTGAAATCTAAAATCAGAGA(5')ATGACTAATACTCAACAGAAAT
TCCAATTTCAAATTACACAAAAGAAAATTCCAAGCGCTTCCTCATCTATTNTCAGTCATCAATGTCTTCTCCGACCATCGGAATATTGTG
AAAGTGGGACCACCTCCGACAACGGCGTGGACATCGGCGTCGGCAACGGCGAGTTCCGGCAGACTGGACATGAAGCATTCAATTTCAGCC
ACgCATCTACGCACATCACATGAAAATAATGCTTACACTCAGGTAACATCCGTAACATCTCCGCTTCCTTGTAATCGCACAAACAAATCG
CACACACGACGTCGTTTCTGCTTCCGTTTCCGTTTCCCCAATTTCCGTTTCTGCTTGAGTAAATTAATTTaGGGTAAGAGTTGATTACTG
CTTGATTGAGGCCCGCGAAAGTGTTCtGAGATGAAACGTCGTCGTTTTCGTCTTCCTCAGCAACGAAAATTACACTCGGAXATGTAAATT
CCGGTGTTCGGGTTTCGAGACTGGGATTGGGCTTGACGGCGGCGATAGGCAGCGGAGCGGCAGCAXTAGGTAAXGATGAAAGGATGAGAG
TTGATAGGAGGAAGAGGAAGGCAAGGGCAATTGCAATTGCXGTAGCCGAGGCCTATTTTGTTGAGGCTCTCGATGAGCgTATTGGTGGTG
GTTAGAGGTGGTGGTGGXACCGCCGTaGGCGGCGGAGGGAATGGTGGACATTGGGAGAATACTAAGAGAAGCTCCATTAGATTAA(3')A
GGGAAAAAATATGGTTTAGATAGGTGGGTGGGTGCATGGGTGGGTGGTATAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan