ESTScan Details for Unigene SGN-U325609

Score 
523
Direction 
Forward
Predicted Peptide Sequence 
SASDQFDWEGDLPLKFSQRNLVIYEMHVRGFTNHESSETKYPGTYLGVVEKLDHLKELGVNCIELMPCHEFNELEYYSYNSVLGDYKFNF
WGYSTVNFFSPMGRYSSAGLSNCGLGAINEFKYLVKEAHKRGIEVIMDVVFNHTAEGNENGPILSFRGIDNSVFYTLAPKGEFYNYSGCG
NTFNCNNPIVRQFIVDCLRYWVTEMHVDGFRFDLASILTRSSSSWNAVNVYGNSIDGDVITTGTPLTSPPLIDMISNDPILRGVKVFKFI
SGSSEEELLFPKTLEKDLYLLLLQLWWPLSFARSFSLGDKMPNLSSXITAKAEAWDCGGLYQVGMFPHWGIWSEWNGKVSCILSRVQLFL
HGFLSHKPELHNGTINFVVSXYAKRGAWIITLXELSCFDSPKMLPHLWILKNTLFLKDLIRTGGIFQESEQHCLRYRDMVRQFIKGTDGF
SGAFAECLCGSPNLYQKGGRKPWNSINFVCAHDGFTLADLVTYNNKHNLAX
Predicted Coding Sequence 
TCTGCTTCTGATCAGTTTGATTGGGAAGGAGATCTACCACTGAAGTTTTCTCAGAGAAATCTGGTAATCTATGAAATGCATGTTCGTGGA
TTTACAAATCATGAGTCGAGTGAAACAAAATATCCTGGTACTTACCTTGGTGTTGTGGAGAAACTTGATCACTTGAAGGAACTTGGTGTC
AACTGTATAGAGCTAATGCCCTGTCACGAGTTCAATGAGCTGGAGTACTATAGTTATAACTCTGTATTGGGCGACTACAAGTTTAACTTT
TGGGGCTATTCTACTGTCAATTTCTTTTCTCCAATGGGAAGATACTCATCTGCTGGTCTAAGTAATTGTGGCCTCGGTGCAATAAACGAA
TTTAAGTATCTTGTCAAGGAAGCACATAAACGTGGAATCGAGGTTATCATGGATGTTGTTTTCAATCACACTGCTGAAGGAAATGAAAAT
GGTCCCATACTATCATTTAGAGGCATTGACAACAGTGTGTTTTATACGCTAGCTCCTAAGGGTGAATTTTACAACTACTCAGGATGTGGA
AATACCTTCAACTGTAATAATCCCATTGTACGTCAATTTATAGTGGATTGCTTGAGATATTGGGTTACCGAAATGCACGTAGATGGCTTC
CGCTTTGATCTTGCTTCTATCCTTACAAGAAGTAGCAGCTCGTGGAATGCTGTAAATGTCTATGGAAATTCAATTGACGGTGACGTGATC
ACCACAGGCACTCCTCTCACAAGCCCACCTTTGATTGATATGATTAGCAATGATCCAATACTTCGTGGAGTAAAGGTTTTTAAGTTTATT
TCTGGTTCCTCTGAGGAAGAACTTTTATTCCCCAAAACCCTTGAGAAGGACTTGTATCTTTTACTTTTGCAACTGTGGTGGCCCCTGAGT
TTTGCTCGTTCCTTCTCTTTGGGTGATAAGATGCCTAATCTTTCCTCTXTTATAACAGCTAAAGCTGAAGCATGGGATTGTGGAGGCCTT
TACCAAGTTGGCATGTTTCCGCACTGGGGTATCTGGTCGGAGTGGAACGGAAAGGTTTCATGCATACTAAGTAGAGTTCAGCTGTTTCTT
CATGGATTCCTGTCTCATAAGCCGGAACTTCATAATGGTACCATCAATTTCGTGGTGTCTCXGTATGCAAAGAGAGGTGCATGGATAATA
ACTCTTGAXGAGCTAAGTTGCTTTGACTCTCCAAAAATGTTGCCACACTTGTGGATCCTTAAAAACACACTATTTTTGAAGGATTTGATA
CGCACCGGTGGCATTTTTCAAGAGTCCGAGCAACATTGCTTGAGGTACCGTGACATGGTACGGCAGTTCATCAAAGGCACTGATGGGTTT
TCTGGGGCTTTTGCTGAATGCCTTTGTGGAAGCCCAAATCTATACCAGAAAGGAGGAAGAAAACCATGGAACAGTATAAATTTCGTGTGT
GCCCACGATGGTTTTACTTTGGCTGATTTAGTGACATATAACAATAAACACAATTTGGCCAAX
Edits in Original Sequence 
(5')TCTGCTTCTGATCAGTTTGATTGGGAAGGAGATCTACCACTGAAGTTTTCTCAGAGAAATCTGGTAATCTATGAAATGCATGTTCG
TGGATTTACAAATCATGAGTCGAGTGAAACAAAATATCCTGGTACTTACCTTGGTGTTGTGGAGAAACTTGATCACTTGAAGGAACTTGG
TGTCAACTGTATAGAGCTAATGCCCTGTCACGAGTTCAATGAGCTGGAGTACTATAGTTATAACTCTGTATTGGGCGACTACAAGTTTAA
CTTTTGGGGCTATTCTACTGTCAATTTCTTTTCTCCAATGGGAAGATACTCATCTGCTGGTCTAAGTAATTGTGGCCTCGGTGCAATAAA
CGAATTTAAGTATCTTGTCAAGGAAGCACATAAACGTGGAATCGAGGTTATCATGGATGTTGTTTTCAATCACACTGCTGAAGGAAATGA
AAATGGTCCCATACTATCATTTAGAGGCATTGACAACAGTGTGTTTTATACGCTAGCTCCTAAGGGTGAATTTTACAACTACTCAGGATG
TGGAAATACCTTCAACTGTAATAATCCCATTGTACGTCAATTTATAGTGGATTGCTTGAGATATTGGGTTACCGAAATGCACGTAGATGG
CTTCCGCTTTGATCTTGCTTCTATCCTTACAAGAAGTAGCAGCTCGTGGAATGCTGTAAATGTCTATGGAAATTCAATTGACGGTGACGT
GATCACCACAGGCACTCCTCTCACAAGCCCACCTTTGATTGATATGATTAGCAATGATCCAATACTTCGTGGAGTAAAGGTTTTTAAGTT
TATTTCTGtGTTCCTCTGAGGAAGtAACTTTTATTCCCCAAAACCCTTGAGAAGGACTTGTATCTTTTACTTTTGCAACTGTGGTGGCCC
CTGAGTTTTGCTaCGTTCCTTCTCTTTGGGTGATAAGATGCCTAATCTTTCCTCTXTTATAACAGCTAAtAGCTGAAGCATGGGATTGTG
GAGGCCTTTACCAAGTTGGCATGTTTCCGCACTGGGGTATCTGGTCGGAGTGGAACGGAAAGGTTTCATGCATACTAAGTAGAGTTCAGC
TGTTTCTTCATGGATTCCTGTCTCATAAGCCGGAACTTCATAATGGTACCATCtAATTTCGTGGTGTCTCXGTATGCAAAGAGAGGTGCA
TGGATAATAACTCTTGAXGAGCTAAGTTGCTTTGACTCTCCAAAAATGTTGCCACACTTGTcGGATCCTTAAAAACACACTATTTTTGAA
GGATTTGATACGCACCGGTcGGCATTTTTCAAGAGTCCGAGCAACATTGCTTGAGGTACCGTGACATGGTACGGCAGTTCATCAAAGGCA
CTGATGGGTTTTCTGGGGCTTTTGCTGAATGCCTTTGTGGAAGCCCAAATCTATACCAGAAAGGAGGAAGAAAACCATGGAACAGTATAA
ATTTCGTGTGTGCCCACGATGGTTTTACTTTGGCTGATTTAGTGACATATAACAATAAACACAATTTGGCCAAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan