ESTScan Details for Unigene SGN-U325626

Score 
318
Direction 
Forward
Predicted Peptide Sequence 
LERYNKMRGNAPERLVSGSDDFTMFLWEPAVSKHPKTRMTGHQQLVNHVYFSPDGQWIASASFDKSVKLWNGTTGKFVAAFRGHVGPVYQ
ISWSADSRLLLSGSKDSTLKVWDIRTKKLKQDLPGHADEVFAVDWSPDGEKVASGGKDRVLKLWMGRNKGDSTPIPMKLLFLPGKFKAPT
FIY
Predicted Coding Sequence 
CTTGAAAGGTACAACAAAATGAGAGGTAATGCCCCTGAGAGGTTGGTATCAGGATCAGATGATTTCACAATGTTTCTATGGGAGCCTGCT
GTCAGCAAGCACCCAAAAACTCGCATGACAGGTCATCAACAGCTGGTTAATCACGTTTATTTTTCTCCGGATGGTCAATGGATAGCAAGT
GCTTCATTCGATAAGTCAGTAAAATTATGGAATGGAACCACAGGAAAATTTGTTGCTGCATTCCGAGGCCATGTTGGACCTGTTTATCAG
ATAAGCTGGTCAGCCGACAGTAGGCTACTTTTGAGTGGGAGCAAAGATTCAACCTTGAAGGTTTGGGATATCCGGACAAAAAAATTGAAA
CAAGACCTTCCCGGCCATGCTGACGAGGTTTTCGCGGTCGACTGGAGTCCAGACGGCGAAAAAGTAGCATCTGGTGGTAAAGATAGAGTT
CTGAAGCTATGGATGGGAAGAAACAAGGGTGACTCCACCCCTATACCAATGAAGCTCTTGTTTTTGCCTGGAAAATTCAAGGCCCCTACT
TTTATTTATTAG
Edits in Original Sequence 
(5')CTTGAAAGGTACAACAAAATGAGAGGTAATGCCCCTGAGAGGTTGGTATCAGGATCAGATGATTTCACAATGTTTCTATGGGAGCC
TGCTGTCAGCAAGCACCCAAAAACTCGCATGACAGGTCATCAACAGCTGGTTAATCACGTTTATTTTTCTCCGGATGGTCAATGGATAGC
AAGTGCTTCATTCGATAAGTCAGTAAAATTATGGAATGGAACCACAGGAAAATTTGTTGCTGCATTCCGAGGCCATGTTGGACCTGTTTA
TCAGATAAGCTGGTCAGCCGACAGTAGGCTACTTTTGAGTGGGAGCAAAGATTCAACCTTGAAGGTTTGGGATATCCGGACAAAAAAATT
GAAACAAGACCTTCCCGGCCATGCTGACGAGGTTTTCGCGGTCGACTGGAGTCCAGACGGCGAAAAAGTAGCATCTGGTGGTAAAGATAG
AGTTCTGAAGCTATGGATGGGAtAGAAACAAGGGTGACTCCACCCCTATACCAATGAAGCTCTTGTTTTTaGCCTGGAAAATTCAAGGCC
CCTACTTTTATTTATTAG(3')ATATATAAAATATGTAATTCAAGTAGTAATCGCCATTCTTATTATTATTAATATTAATGATATACGTG
AGCTTTTTACCAGCCATTAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan