ESTScan Details for Unigene SGN-U325716

Score 
306
Direction 
Forward
Predicted Peptide Sequence 
MSLYVCFFFTLLFLGCPPKLLSMPVLPKPDPVEVRSQTFLPSSAPPATIPAFPEQSNVPGCPLDLPEDLYHSVKSACGSHGYSGQVHQTR
CCPVLAAWLYSAYSRTALHRAVTKLPQSTSIDMPVLPDDSETCVDSIEKALANRGIELVKPNKTCDVFYCYWGIRLHPLSCPEAFSVDSK
GKLVGDKSVKRLERDCLSNNGYTGLAGCSKCLNSLYQLSEARVGNKSRLEDRTXENAKQGLPIDGSNMASQQKSIQLHSHGFFCFKGSNV
DGRQFRSSVVPLNSDGMPLAVDSTEINDESAAVSXSSII
Predicted Coding Sequence 
ATGTCCCTCTACGTTTGCTTCTTCTTCACTCTACTTTTCTTGGGTTGTCCACCCAAATTACTCTCCATGCCGGTTTTACCCAAACCTGAC
CCAGTTGAGGTCCGTTCTCAAACATTCTTACCTTCCTCTGCACCGCCGGCCACAATTCCTGCTTTTCCGGAGCAGTCGAACGTCCCCGGT
TGCCCACTGGATCTGCCGGAAGACCTCTACCATAGCGTTAAATCAGCTTGTGGGTCCCATGGTTATTCGGGTCAAGTACACCAGACCCGC
TGTTGCCCTGTTCTAGCTGCCTGGCTCTACTCCGCTTACTCTAGAACGGCACTACACAGAGCTGTTACGAAACTACCACAATCGACTTCG
ATTGATATGCCGGTGCTCCCTGATGATTCGGAGACGTGTGTGGACTCTATTGAAAAGGCCTTGGCGAACAGAGGGATTGAATTAGTGAAG
CCAAACAAGACTTGTGATGTATTTTATTGTTATTGGGGAATTAGGCTTCATCCACTCAGTTGCCCAGAAGCATTCTCTGTGGATTCAAAA
GGGAAATTGGTAGGTGATAAAAGCGTGAAGAGATTGGAAAGAGATTGTTTGAGCAATAATGGGTATACTGGTCTGGCTGGTTGCTCCAAG
TGCTTGAACAGTCTTTATCAACTTAGTGAGGCCAGAGTTGGAAACAAGAGCAGGTTAGAGGATAGGACTXAGGAAAATGCGAAGCAGGGA
TTGCCAATTGATGGGTCTAACATGGCTTCTCAACAAAAATCGATCCAGTTACATTCACACGGTTTCTTCTGTTTTAAGGGCTCTAATGTT
GACGGAAGGCAGTTCAGATCCTCAGTCGTGCCACTCAACAGTGATGGTATGCCTCTTGCAGTAGACTCCACGGAGATCAACGATGAATCT
GCTGCAGTTTCTXATTCAAGCATCATTTAA
Edits in Original Sequence 
GCCTCTCATCCACTTATTTTTTTTTTTTTGGCTATACCAAAAGCACTGAACTTCACATTTCCCTCATTCTCAAAGCA(5')ATGTCCCTC
TACGTTTGCTTCTTCTTCACTCTACTTTTCTTGGGTTGTCCACCCAAATTACTCTCCATGCCGGTTTTACCCAAACCTGACCCAGTTGAG
GTCCGTTCTCAAACATTCTTACCTTCCTCTGCACCGCCGGCCACAATTCCTGCTTTTCCGGAGCAGTCGAACGTCCCCGGTTGCCCACTG
GATCTGCCGGAAGACCTCTACCATAGCGTTAAATCAGCTTGTGGGTCCCATGGTTATTCGGGTCAAGTACACCAGACCCGCTGTTGCCCT
GTTCTAGCTGCCTGGCTCTACTCCGCTTACTCTAGAACGGCACTACACAGAGCTGTTACGAAACTACCACAATCGACTTCGATTGATATG
CCGGTGCTCCCTGATGATTCGGAGACGTGTGTGGACTCTATTGAAAAGGCCTTGGCGAACAGAGGGATTGAATTAGTGAAGCCAAACAAG
ACTTGTGATGTATTTTATTGTTATTGGGGAATTAGGCTTCATCCACTCAGTTGCCCAGAAGCATTCTCTGTGGATTCAAAAGGGAAATTG
GTAGGTGATAAAAGCGTGAAGAGATTGGAAAGAGATTGTTTGAGCAATAATGGGTATACTGGTCTGGCTGGTTGCTCCAAGTGCTTGAAC
AGTCTTTATCAACTTAGTGAGGCCAGAGTTGGAAACAAGAGCAGGTTAGAGGATAGGACTXAGGAAAATGCGAAGCAGGGATTGCCAATT
GATGGGTCTAACATGGCTTCTCAACAAAAATCGATCCAGTTACATTCACACGGTTTCTTCTGTTTTAAGGGCTCTAATGTTGACGGAAGG
CAGTTCAGATCCTCAGTCGTGCaCACTCAACAGTGATGGTATGCCTCTTGCAGTAGACTCCACGGAGATCAACGATGAATCTGCTGCAGT
TTCTXATTCAAGCATCATTTAA(3')TCCATATATCCTAACTCTAGTTTTAGTGTACATAAACTGTGTGTCATTGCTCTTCAAATATTAG
TTAATCTCCAGCAGTTGAACATTGTACTAAAAAAAATGTAGCTGTTGTTCAAATGCCACGTAGGGCAAATTCAGTCCTCTGTATTCGTTC
ATTCAGGTTAGTGATATTGTAATTTTTGTGGTTGTCTAACGACTGTTCATCAAATGAATGAAGCTATGGATGTTCATGCATCAAAAAAAA
AAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan