ESTScan Details for Unigene SGN-U325844

Score 
1254
Direction 
Forward
Predicted Peptide Sequence 
MPQTMMIFLKPFISPSSSSLWSKSNSGENSLNTNVKMCKRAEVVCQGMLTPRKFMQKRRKVEVFKSAEDEADQKNWRKMMNEIEEAGSAV
SVLRTQRDKNQALPKNLVLGSLVRFKQLKKWNLVSEILEWLRTQHWWDFNEMDFLMLITAYGKQGDFSKAERILGYMNKKGYPANVISHT
ALMEAYGKGGQYAKAEAIFRRMQTSGPEPSAITYQIILKIFVEGDKFNEAQDVFEALMDMDAPPLKPDQKMFHMMIYMYKKAGKYEKARH
LFSLMTERGIPQNTVTYNSLMSFETNYKEVANIYDQMQRAGLQPDVVSYALLISAYGKARREEEALAVFEEMLVAGVRPTQKSYNILLDA
FA
Predicted Coding Sequence 
ATGCCTCAAACAATGATGATATTCCTCAAACCATTCATTTCTCCTTCATCTTCTTCTCTTTGGAGTAAATCAAATAGTGGTGAGAATTCA
TTGAATACAAATGTTAAAATGTGTAAAAGAGCTGAAGTGGTGTGTCAAGGCATGCTGACGCCGAGAAAGTTCATGCAGAAGAGGAGGAAA
GTAGAGGTTTTCAAGAGTGCTGAGGATGAAGCAGATCAGAAAAACTGGAGAAAGATGATGAATGAAATTGAAGAAGCTGGTTCTGCTGTT
TCAGTGCTGAGAACCCAGAGGGACAAGAACCAGGCTCTTCCAAAGAACCTTGTTCTTGGAAGCTTGGTTAGATTTAAGCAGCTTAAGAAG
TGGAACCTTGTTAGTGAGATTCTTGAATGGCTTCGAACTCAGCATTGGTGGGATTTTAATGAGATGGACTTTCTGATGCTTATTACAGCT
TACGGGAAGCAAGGGGACTTCAGTAAAGCTGAAAGGATTTTAGGCTACATGAATAAGAAGGGCTATCCTGCCAATGTGATATCACACACT
GCTCTGATGGAGGCATATGGAAAAGGAGGTCAGTATGCCAAGGCAGAAGCGATATTTCGGAGAATGCAAACTTCAGGCCCTGAGCCTTCT
GCTATTACATACCAAATCATTCTCAAAATCTTTGTTGAGGGTGACAAGTTTAATGAAGCTCAAGATGTCTTTGAAGCCCTTATGGATATG
GATGCACCTCCTCTAAAACCAGACCAGAAAATGTTCCACATGATGATCTATATGTATAAGAAGGCAGGAAAATATGAAAAAGCTCGTCAT
CTATTTTCTTTGATGACCGAGCGAGGAATTCCACAAAATACCGTTACTTACAACAGTTTGATGTCATTTGAGACCAACTATAAGGAGGTC
GCAAACATTTATGATCAGATGCAAAGAGCTGGTCTTCAACCTGATGTTGTTAGCTATGCACTGCTCATTAGTGCATATGGAAAGGCTAGA
AGAGAAGAGGAGGCACTAGCTGTTTTTGAGGAAATGCTTGTAGCTGGTGTCAGGCCAACACAAAAGTCTTACAACATCTTGCTAGATGCA
TTTGCX
Edits in Original Sequence 
TTCAACTCCATGAGCATGAAAGTTGGAGTCTTGTAGTGCAGTGAAGGTGAAGGGGAACCATTGTAA(5')ATGCCTCAAACAATGATGAT
ATTCCTCAAACCATTCATTTCTCCTTCATCTTCTTCTCTTTGGAGTAAATCAAATAGTGGTGAGAATTCATTGAATACAAATGTTAAAAT
GTGTAAAAGAGCTGAAGTGGTGTGTCAAGGCATGCTGACGCCGAGAAAGTTCATGCAGAAGAGGAGGAAAGTAGAGGTTTTCAAGAGTGC
TGAGGATGAAGCAGATCAGAAAAACTGGAGAAAGATGATGAATGAAATTGAAGAAGCTGGTTCTGCTGTTTCAGTGCTGAGAACCCAGAG
GGACAAGAACCAGGCTCTTCCAAAGAACCTTGTTCTTGGAAGCTTGGTTAGATTTAAGCAGCTTAAGAAGTGGAACCTTGTTAGTGAGAT
TCTTGAATGGCTTCGAACTCAGCATTGGTGGGATTTTAATGAGATGGACTTTCTGATGCTTATTACAGCTTACGGGAAGCAAGGGGACTT
CAGTAAAGCTGAAAGGATTTTAGGCTACATGAATAAGAAGGGCTATCCTGCCAATGTGATATCACACACTGCTCTGATGGAGGCATATGG
AAAAGGAGGTCAGTATGCCAAGGCAGAAGCGATATTTCGGAGAATGCAAACTTCAGGCCCTGAGCCTTCTGCTATTACATACCAAATCAT
TCTCAAAATCTTTGTTGAGGGTGACAAGTTTAATGAAGCTCAAGATGTCTTTGAAGCCCTTATGGATATGGATGCACCTCCTCTAAAACC
AGACCAGAAAATGTTCCACATGATGATCTATATGTATAAGAAGGCAGGAAAATATGAAAAAGCTCGTCATCTATTTTCTTTGATGACCGA
GCGAGGAATTCCACAAAATACCGTTACTTACAACAGTTTGATGTCATTTGAGACCAACTATAAGGAGGTCGCAAACATTTATGATCAGAT
GCAAAGAGCTGGTCTTCAACCTGATGTTGTTAGCTATGCACTGCTCATTAGTGCATATGGAAAGGCTAGAAGAGAAGAGGAGGCACTAGC
TGTTTTTGAGGAAATGCTTGTAGcCTGGTGTCAGGCCAACACAAAAGTCTTACAACATCTTGCTAGATGCATTTGCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan