ESTScan Details for Unigene SGN-U325887

Score 
464
Direction 
Forward
Predicted Peptide Sequence 
MSCFSCMSSRPKIIEDYDEDMTSRSNNSAVHARGNSSDSGSGNGRKEGFFRSKKSGESNNQNNNVARSFAFKELAIATQSFRETNLIGEG
GFGSVYKGRIDSGQIVAIKQLNLEGLQGNQEFVVEVLMLSLMHHNNLVNLIGYCTXRRTEVVGLRVYATRQPGKPSFRFRTRNDATELED
KAKDSPGAAHGLEYLHKANPPVIYRDLKSSNILLDNDFNPKLSDFGLAKLGPVGDNTHVSXRVMGTYGYCAPEYAMTGKVTLKSDIY
Predicted Coding Sequence 
ATGAGTTGTTTTTCTTGCATGAGCTCTCGTCCTAAGATTATTGAAGATTATGATGAAGATATGACCTCAAGATCCAACAATTCTGCAGTC
CACGCGAGGGGAAATTCTAGTGATTCAGGAAGTGGAAATGGGAGAAAGGAAGGCTTTTTTAGAAGTAAAAAAAGTGGGGAAAGTAACAAT
CAGAACAACAATGTAGCTCGGAGTTTCGCGTTCAAGGAACTAGCCATCGCAACTCAGAGTTTTAGGGAAACAAATCTTATTGGCGAAGGC
GGCTTTGGAAGTGTCTATAAAGGCCGTATAGATTCAGGCCAGATAGTCGCGATCAAACAACTTAATCTCGAAGGCCTTCAAGGGAACCAA
GAATTTGTTGTGGAGGTACTTATGTTGAGTTTAATGCATCATAACAATCTTGTCAATCTGATCGGATACTGCACTXCACGGAGAACAGAG
GTTGTTGGTTTACGAGTTTATGCCACTAGGCAGCCTGGAAAACCATCTTTTCGATTTAGAACCAGGAACGACGCCACTGAGTTGGAAGAC
AAGGCTAAAGATAGCCCAGGTGCAGCTCATGGACTCGAGTATCTACACAAAGCAAATCCACCCGTCATCTACCGTGATTTGAAATCTTCA
AATATATTATTGGACAATGATTTCAATCCAAAGCTGTCGGATTTTGGACTTGCAAAACTTGGACCGGTAGGTGACAACACTCATGTTTCG
ANCAGAGTGATGGGAACCTACGGATATTGTGCCCCCGAGTATGCCATGACTGGGAAAGTGACTCTGAAATCTGATATCTAT
Edits in Original Sequence 
AATAAACTATCTTTTTCTCTCTCTCTCTCTCCTTAGCTCCATTTATATCTTGCATTTTTTTTTTTTGATTCCTCCTATATATATCATTAC
TATTTTTATTTTTATTTTTTTGTAATTATGTAATCAACAAATGATTTTCTAGCTGAAATTTGAGGTGTTATTATTCTAATTTCTTGAAAT
CTTTTGCATTTGTTTTGGAAATACTTGGCCAAAGATTTCAATGTTGAAAAAAAATAATAATAAA
(5')ATGAGTTGTTTTTCTTGCATGA
GCTCTCGTCCTAAGATTATTGAAGATTATGATGAAGATATGACCTCAAGATCCAACAATTCTGCAGTCCACGCGAGGGGAAATTCTAGTG
ATTCAGGAAGTGGAAATGGGAGAAAGGAAGGCTTTTTTAGAAGTAAAAAAAGTGGGGAAAGTAACAATCAGAACAACAATGTAGCTCGGA
GTTTCGCGTTCAAGGAACTAGCCATCGCAACTCAGAGTTTTAGGGAAACAAATCTTATTGGCGAAGGCGGCTTTGGAAGTGTCTATAAAG
GCCGTATAGATTCAGGCCAGATAGTCGCGATCAAACAACTTAATCTCGAAGGCCTTCAAGGGAACCAAGAATTTGTTGTGGAGGTACTTA
TGTTGAGTTTAATGCATCATAACAATCTTGTCAATCTGATCGGATACTGCACTXCACGGAGAACAGAGGTTGTTGGTTTACGAGTTTATG
CCACTAGGCAGCCTGGAAAACCATCTTTTCGATTTAGAACCAGGAACGACGCCACTGAGTTGGAAGACAAGGCTAAAGATAGCCgCAGGT
GCAGCTCATGGACTCGAGTATCTACACAAAGCAAATCCACCCGTCATCTACCGTGATTTGAAATCTTCAAATATATTATTGGACAATGAT
TTCAATCCAAAGCTGTCGGATTTTGGACTTGCAAAACTTGGACCGGTAGGTGACAACACTCATGTTTCGANCAGAGTGATGGGAACCTAC
GGATATTGTGCCCCCGAGTATGCCATGACTGGGAAAGTGACTCTGAAATCTGATATCTAT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan