ESTScan Details for Unigene SGN-U325942

Score 
236
Direction 
Forward
Predicted Peptide Sequence 
TLKNGNVVAVKKLAIMSSRAKADFETEVRLISNVHHRNLIRLLGCSNKASDLLLVYEYMAMAASKDTYMETDEGCSTGSKDSXIIFGTAR
GLAYLHEQFHVCIIHRDIKSSNILLDDEFQPKIADFGLVRLLPFRESYLILAGEIGWKLHETGTPVKLVDETLDPNEYNEQEVKKVIEIA
LMCTQSPANLRPSMSEVVVMLLSDRSTESRTPSRPTIISMDKSKAFDASMTTGSSASTATNTFSDFTAASXVVTNNNYASVPNKLRYRHY
VGWPHNDSYIVMFI
Predicted Coding Sequence 
ACTTTGAAAAACGGAAATGTAGTAGCTGTTAAAAAACTAGCAATTATGTCAAGCAGAGCGAAAGCAGATTTTGAGACTGAAGTTCGTCTT
ATCAGTAATGTCCATCATCGCAATCTCATCCGTCTCTTGGGATGTTCAAACAAAGCATCAGACCTACTACTTGTTTACGAATACATGGCA
ATGGCAGCCTCGAAAGATACTTATATGGAGACAGACGAGGGATGCTCAACTGGAAGCAAAGATTCAATXATAATCTTTGGCACAGCTCGT
GGCCTTGCATACTTGCACGAGCAATTCCACGTCTGCATCATCCATCGAGATATAAAATCCAGCAACATTCTACTAGACGACGAATTCCAG
CCAAAGATAGCTGATTTTGGGCTTGTAAGACTTTTACCTTTTCGCGAGTCCTATCTAATCTTGGCTGGTGAAATAGGCTGGAAGCTTCAT
GAAACTGGCACGCCTGTAAAACTAGTGGACGAGACATTAGACCCCAACGAATACAACGAACAAGAAGTGAAGAAAGTCATAGAGATCGCG
TTAATGTGCACACAGTCACCAGCAAATCTTAGGCCAAGCATGTCTGAAGTTGTTGTGATGCTATTAAGCGATCGTAGCACAGAATCAAGA
ACTCCAAGCAGGCCTACTATCATTAGCATGGATAAGAGTAAAGCATTCGACGCATCCATGACTACAGGATCATCAGCTTCAACTGCAACC
AACACTTTTAGTGATTTCACCGCCGCTAGTAXTGTTGTAACAAACAACAACTACGCTTCTGTTCCAAACAAGTTGAGGTATAGACATTAT
GTTGGTTGGCCCCATAATGATTCTTATATAGTCATGTTCATATAA
Edits in Original Sequence 
(5')ACTTTGAAAAACGGAAATGTAGTAGCTGTTAAAAAACTAGCAATTATGTCAAGCAGAGCGAAAGCAGATTTTGAGACTGAAGTTCG
TCTTATCAGTAATGTCCATCATCGCAATCTCATCCGTCTCTTGGGATGTTCAAACAAAGCATCAGACCTACTACTTGTTTACGAATACAT
GGCaAATGGCAGCCTCGAAAGATACTTATATGGAGACAGACGAGGGATGCTCAACTGGAAGCAAAGATTCAATXATAATCTTTGGCACAG
CTCGTGGCCTTGCATACTTGCACGAGCAATTCCACGTCTGCATCATCCATCGAGATATAAAATCCAGCAACATTCTACTAGACGACGAAT
TCCAGCCAAAGATAGCTGATTTTGGGCTTGTAAGACTTTTACCTTTTCGCGAGTCCTATCTAATCTTGGCaTGGTGAAATAGGCgTGGAA
GCTTCATGAAACTGGCACGCCTGTAAAACTAGTGGACGAGACATTAGACCCCAACGAATACAACGAACAAGAAGTGAAGAAAGTCATAGA
GATCGCGTTAATGTGCACACAGTCACCAGCAAATCTTAGGCCAAGCATGTCTGAAGTTGTTGTGATGCTATTAAGCGATCGTAGCACAGA
ATCAAGAACTCCAAGCAGGCCTACTATCATTAGCATGGATAAGAGTAAAGCATTCGACGCATCCATGACTACAGGATCATCAGCTTCAAC
TGCAACCAACACTTTTAGTGATTTCACCgGCCGCTAGTAXTGTTGTAACAAACAACAACTACGCTTCTGTTCCAAACAAGTTGAGGTATA
GACATTATGTTGGTTGGCCCCATAATGATTCTTATATAGTCATGTTCATATAA(3')ATAGTAAAAACATGCAAGTACAATAAAGAGTAG
AACATTTATATAATTCTTTCGAAATTGCTCTTGGTAGCATTTAAATATTATTCCGTGTGATTCAATTGGTTTGTTTTACTTTCATTTTTC
GTCTATTACAAAAATAATTCTTTTTCCTTGTTTTGGCATCTCTTTAATTTCAATTTTCCGATTGATATGTATAAACCATAAGATTAAATG
ACATTTTGGTACTTCATACATATCTTTAATCTAAGACAAATTTAAAAGTCTCTTTTATCTTCTTAAAATGGGTATCAAGTCAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan