ESTScan Details for Unigene SGN-U325976

Score 
417
Direction 
Forward
Predicted Peptide Sequence 
SIAIEIEKASISLLHRKDKIMLLNSSFLLSNISLSYTLSACHTTQSFPRQKSTFQCCLAATLQDKRVRELNVNILHYEDNMKRRSLLFFL
ITSGISPAFPAFGKTKSKNPYDERRLLEQNKRIQRENNAPEEFPSFIREGFTVKVVTPENYEKRDSGLILRDFSVGEGDCPKDGQQVTFH
YIGYNESGRRIDSTYVQGSPAKIRMGTKALVPGFEEGIRDMRPGGKRRIIIPPELGPPVGPSTFFSSKQFEVFDXGIARRPRLQT
Predicted Coding Sequence 
XXTTCCATTGCAATTGAAATTGAGAAAGCTTCAATCTCCCTTTTGCATAGAAAGGACAAAATCATGCTTCTCAACTCTTCATTTCTTCTG
TCCAACATTTCTCTTTCATATACTCTATCAGCTTGTCATACAACTCAATCTTTTCCCAGACAGAAGTCAACATTCCAGTGTTGCTTAGCT
GCCACATTACAAGATAAAAGGGTTAGGGAACTGAATGTAAATATATTGCATTATGAGGACAACATGAAGCGCAGATCTCTCCTGTTTTTT
CTGATTACATCCGGCATATCTCCCGCTTTTCCAGCTTTTGGGAAAACAAAGAGCAAAAACCCGTATGATGAAAGACGCTTACTAGAGCAG
AACAAACGGATCCAGAGAGAAAATAATGCCCCTGAAGAGTTCCCCAGTTTCATCAGAGAAGGTTTTACAGTTAAAGTAGTAACGCCTGAA
AATTACGAAAAGCGTGATTCAGGTCTTATATTGCGGGATTTTTCTGTTGGTGAAGGTGATTGCCCAAAGGATGGTCAACAGGTGACTTTC
CACTATATTGGGTATAATGAGTCTGGACGTCGTATTGACAGCACATATGTTCAAGGTTCTCCTGCAAAGATTCGGATGGGCACTAAAGCA
TTGGTCCCAGGTTTTGAGGAAGGAATTAGAGACATGAGACCTGGGGGCAAAAGGAGGATAATCATACCTCCAGAATTAGGACCTCCGGTT
GGGCCTTCAACATTCTTTAGCTCAAAACAGTTCGAAGTATTTGATGXTGGAATTGCTAGACGTCCAAGACTGCAAACGTAG
Edits in Original Sequence 
(5')XXTTCCATTGCAATTGAAATTGAGAAAGCTTCAATCTCCCTTTTGCATAGAAAGGACAAAATCATGCTTCTCAACTCTTCATTTCT
TCTGTCCAACATTTCTCTTTCATATACTCTATCAGCTTGTCATACAACTCAATCTTTTCCCAGACAGAAGTCAACATTCCAGTGTTGCTT
AGCTGCCACATTACAAGATAAAAGGGTTAGGGAACTGAATGTAAATATATTGCATTATGAGGACAACATGAAGCGCAGATCTCTCCTGTT
TTTTCTGATTACATCCGGCATATCTCCCGCTTTTCCAGCTTTTGGGAAAACAAAGAGCAAAAACCCGTATGATGAAAGACGCTTACTAGA
GCAGAACAAACGGATCCAGAGAGAAAATAATGCCCCTGAAGAGTTCCCCAGTTTCATCAGAGAAGGTTTTACAGTTAAAGTAGTAACGCC
TGAAAATTACGAAAAGCGTGATTCAGGTCTTATATTGCGGGATTTTTCTGTTGGTGAAGGTGATTGCCCAAAGGATGGTCAACAGGTGAC
TTTCCACTATATTGGGTATAATGAGTCTGGACGTCGTATTGACAGCACATATGTTCAAGGTTCTCCTGCAAAGATTCGGATGGGCACTAA
AGCATTGGTCCCAGGTTTTGAGGAAGGAATTAGAGACATGAGACCTGGGGGCAAAAGGAGGATAATCATACCTCCAGAATTAGGACCTCC
GGTTGGGCCTTCAACATTCTTTAGCTCAAAACAGTTCGAAGTATTTGATGXTGGAATTGCTAGACGTCCAAGACTGCAAACGTAG(3')G
ACAATAGGCTTCTACTCTGATGTTGTTTGCAATTGAACAATAAGCTCATGTTGTGAATATTTCAGTCACATCTTGTATCATTGCTATCAG
GAGAAGATACTTTTTTTTTGTACAGCAACAGAAGCAGCAACACGAGACTAGTCTAGAGATCAGAAGGTAGTTATAGTTCTGAATCTTTTG
ATTTATGCTGAAAGTAATAGCAGACTATTTGATTTATGCTGAAAGTAATAGCAGACTATCCTACAGTTTGTAGACTTNNNNAAANAAAAA
AAAAANAAAAAAAAAAAAAANANAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan