ESTScan Details for Unigene SGN-U326157

Score 
566
Direction 
Forward
Predicted Peptide Sequence 
KPKEEKKTEEGEKDAKKTEEGEKAAAAAETAASATTAAAAPSEEPSEGAAASAKEVGVEEDPKLEMKKNELYYYYPQQLNYHHYPQIYAS
HEMYNPYPPQMFSDENPNACSVM
Predicted Coding Sequence 
XATAAACCTAAAGAAGAGAAAAAAACAGAGGAAGGTGAAAAAGACGCGAAAAAAACAGAGGAAGGAGAGAAGGCGGCGGCGGCGGCGGAG
ACAGCXGCCTCCGCCACCACTGCTGCTGCAGCTCCTTCGGAAGAGCCTTCCGAAGGAGCTGCTGCATCAGCTAAAGAAGTTGGTGTTGAA
GAAGATCCAAAACTAGAAATGAAGAAGAATGAGCTTTACTACTATTACCCACAGCAGCTAAATTACCATCATTACCCTCAAATATATGCA
TCACATGAGATGTATAATCCTTACCCTCCACAAATGTTTAGTGATGAGAACCCCAATGCATGTTCTGTGATGTAA
Edits in Original Sequence 
(5')XATAAACCTAAAGAAGAGAAAAAAACAGAGGAAGGTGAAAAAGACGCGAAAAAAACAGAGGAAGGAGAGAAgGGCGGCGGCGGCGG
CGGAGACAGCXGCCTCCGCCACCACTGCTGCTGCAGCTCCTTCGGAAGAGCCTTCCGAAGGAGCTGCTGCATCAGCTAAAGAAGTTGGTG
TTGAAGAAGATCCAAAACTAGAAATGAAGAAGAATGAGCTTTACTACTATTACCCACAGCAGCTAAATTACCATCATTACCCTCAAATAT
ATGCATCACATGAGATGTATAATCCTTACCCTCCACAAATGTTTAGTGATGAGAACCCCAATGCATGTTCTGTGATGTAA(3')ATTTGT
AAGAACATGAAGGGTATATGTGGAAAGAATTAGAGTTATGGTCACATGGGAAATGTCCATGTCCATTTCTCTTAACTTGTTGTTTATGGT
TGTGCTCTACATGTGGCCCTGTCTGGGGGACCTTGCACCCAAAAAAAAAAAACCTAGAGAATTTTGTAAGCACTTTGTACCTTTTTCATT
GGGTTTTTAATTATATAATATTCTTGTTATATAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan