ESTScan Details for Unigene SGN-U326169

Score 
1518
Direction 
Forward
Predicted Peptide Sequence 
TTILFSSKSDTESPTLSSAMATPEEAXAPPVSSMAKVKXEQNYVVAESNTVNPVKGXGIFSSNHASDGILLVVPLDLAITPMGVLQDPLL
GPECRAMFEEGEVDDRLLITLFLTVEHLRENSSWKPYFDMLPTTFGNPLWFSEDELLELKGTTLYRAAQLQKKTLQSLFDEKVKRLAKKL
LTLDGHPERDVKFEDFLWANSIFWSRALNIPFPRCYIFPMNSEGQDSDISSKVINSAIQTNGCGSLSNGESAKVPEYDTLQDKVASAASV
SQGEIVWVEGLVPGIDFCNHDFKAAATWEVDGTGATTGVPFSMYLLSAGENPSLIEKEISISYGNKGNEELLYLYGFVMNDNPDDYLMVH
YPVEAIQNVDFSDSKAQLLEAQKAXIEMSLTPKFAKSRIFPPSNSSEEDKDKPVSSQLCNYSWSGQRKTPSYLHKLVFPADFLNALRTLA
MKENELYRVSSLLEELVGSGGERQPTDTEVQAAVWEACGDSGALQLLVDLLNMKMMDLEEGSGTEENDTELLEKARTAETSQDCKEYDQX
TTIVTNMEIACRFNFVNTNFTADPGPVTLPESFAGRNKQSSIIYRRGQKQLTRLFIKEAEHALQLALTEEXLDKSNPRFYILQDSYLSKY
LGND
Predicted Coding Sequence 
XXGACGACAATTTTGTTTTCGTCGAAGAGCGACACAGAATCTCCAACACTGTCTTCGGCAATGGCGACTCCTGAAGAAGCTAAXGCTCCA
CCAGTTTCTTCAATGGCTAAAGTTAAAXCAGAGCAGAACTACGTGGTTGCAGAATCAAATACAGTGAATCCAGTAAAGGGTXTTGGAATT
TTCTCATCTAATCATGCATCTGATGGGATACTACTGGTGGTTCCATTAGATTTGGCTATAACTCCAATGGGTGTACTTCAAGATCCTCTT
CTTGGACCTGAATGTAGGGCTATGTTTGAGGAAGGGGAAGTAGATGATAGACTCTTGATTACCTTATTTCTAACTGTGGAGCACCTACGA
GAAAACTCTTCATGGAAGCCGTACTTTGATATGCTTCCAACCACATTCGGGAATCCACTTTGGTTTTCTGAAGACGAGCTTTTAGAGCTT
AAAGGAACCACATTGTATCGGGCTGCTCAGTTGCAGAAAAAAACACTGCAGTCTTTATTTGATGAAAAGGTGAAAAGGTTGGCTAAGAAG
CTTTTAACTCTTGATGGACATCCAGAAAGAGATGTGAAGTTTGAAGACTTCCTTTGGGCAAACTCCATATTTTGGAGTCGAGCACTAAAT
ATCCCTTTTCCGCGCTGCTATATATTTCCTATGAATTCAGAAGGACAAGATAGTGACATTTCTAGCAAAGTCATCAATTCTGCAATACAA
ACTAATGGTTGCGGCAGTTTATCTAATGGAGAGTCTGCAAAAGTACCCGAATATGATACACTCCAAGATAAAGTTGCTTCTGCTGCTTCC
GTTTCACAAGGAGAGATAGTTTGGGTGGAAGGTCTGGTCCCAGGCATTGATTTTTGCAACCATGATTTCAAAGCTGCAGCAACATGGGAA
GTTGATGGAACAGGAGCAACAACTGGAGTTCCTTTCTCCATGTACCTTCTTTCTGCTGGAGAAAATCCTTCCCTGATCGAGAAAGAGATA
TCAATTAGCTATGGGAACAAGGGAAATGAGGAACTGCTGTACCTGTATGGATTCGTCATGAATGATAATCCTGATGACTACCTCATGGTT
CATTATCCGGTGGAAGCTATTCAAAACGTTGATTTCTCAGATTCGAAAGCTCAACTTCTTGAAGCACAGAAAGCTGAXATTGAGATGTCT
CTTACCCCGAAGTTTGCTAAATCGCGGATTTTCCCTCCATCCAACTCATCTGAGGAAGATAAAGATAAACCCGTCAGTAGTCAACTTTGT
AACTATAGTTGGAGTGGTCAGCGAAAGACGCCCTCTTACTTGCACAAGCTAGTTTTTCCTGCAGACTTTTTGAATGCATTGAGAACCTTA
GCAATGAAAGAAAATGAGCTTTATCGTGTTTCTTCTCTACTTGAGGAGCTTGTTGGATCTGGAGGAGAAAGGCAGCCAACTGACACAGAA
GTTCAAGCAGCAGTATGGGAGGCTTGTGGAGATTCTGGAGCTTTACAACTTCTTGTTGATCTGCTTAACATGAAGATGATGGATCTGGAA
GAGGGTTCAGGAACAGAGGAGAATGACACTGAATTACTCGAGAAAGCTCGCACTGCAGAAACCTCACAAGATTGCAAAGAGTATGATCAA
AAXACTACTATAGTTACCAACATGGAAATAGCATGCAGGTTTAACTTTGTTAATACTAACTTTACTGCCGATCCAGGACCAGTGACATTG
CCAGAATCATTTGCTGGTAGAAATAAGCAATCTAGTATAATATACAGGCGGGGGCAGAAACAACTAACTCGTCTCTTCATTAAGGAAGCA
GAGCACGCGTTGCAGTTAGCATTGACCGAAGAAXCTCTAGATAAATCTAACCCAAGATTTTACATTCTGCAAGATAGCTATTTGAGCAAA
TATTTAGGTAATGATTGA
Edits in Original Sequence 
(5')XXGACGACAATTTTGTTTTCGTCGAAGAGCGACACAGAATCTCCAACACTGTCTTCGGCAATGGCGACTCCTGAAGAAGCTAAXGC
TCCACCAGTTTCTTCAATGGCTAAAGTTAAAXCAGAGCAGAACTACGTGGTTGCAGAATCAAATACAGTGAATCCAGTAAAGGGTXTTGG
AATTTTCTCATCTAATCATGCATCTGATGGGATACTACTGGTGGTTCCATTAGATTTGGCTATAACTCCAATGGGTGTACTTCAAGATCC
TCTTCTTGGACCTGAATGTAGGGCTATGTTTGAGGAAGGGGAAGTAGATGATAGACTCTTGATTACCTTATTTCTAACTGTGGAGCACCT
ACGAGAAAACTCTTCATGGAAGCCGTACTTTGATATGCTTCCAACCACATTCGGGAATCCACTTTGGTTTTCTGAAGACGAGCTTTTAGA
GCTTAAAGGAACCACATTGTATCGGGCTGCTCAGTTGCAGAAAAAAACACTGCAGTCTTTATTTGATGAAAAGGTGAAAAGGTTGGCTAA
GAAGCTTTTAACTCTTGATGGACATCCAGAAAGAGATGTGAAGTTTGAAGACTTCCTTTGGGCAAACTCCATATTTTGGAGTCGAGCACT
AAATATCCCTTTTCCGCGCTGCTATATATTTCCTATGAATTCAGAAGGACAAGATAGTGACATTTCTAGCAAAGTCATCAATTCTGCAAT
ACAAACTAATGGTTGCGGCAGTTTATCTAATGGAGAGTCTGCAAAAGTACCCGAATATGATACACTCCAAGATAAAGTTGCTTCTGCTGC
TTCCGTTTCACAAGGAGAGATAGTTTGGGTGGAAGGTCTGGTCCCAGGCATTGATTTTTGCAACCATGATTTCAAAGCTGCAGCAACATG
GGAAGTTGATGGAACAGGAGCAACAACTGGAGTTCCTTTCTCCATGTACCTTCTTTCTGCTGGAGAAAATCCTTCCCTGATCGAGAAAGA
GATATCAATTAGCTATGGGAACAAGGGAAATGAGGAACTGCTGTACCTGTATGGATTCGTCATGAATGATAATCCTGATGACTACCTCAT
GGTTCATTATCCGGTGGAAGCTATTCAAAACGTTGATTTCTCAGATTCGAAAGCTCAACTTCTTGAAGCACAGAAAGCTGAXATTGAGAT
GTCTCTTACCCCGAAGTTTGCTAAATCGCGGAtTTTTCCCTCCATCCAACTCATCTGAGGAAGATAAAGATAAACCCGTCAGTAGTCAAC
TTTGTAACTATAGTTGGAGTGGTCAGCGAAAGACGCCCTCTTACTTGCACAAGCTAGTTTTTCCTGCAGACTTTTTGAATGCATTGAGAA
CCTTAGCAATGAAAGAAAATGAGCTTTATCGTGTTTCTTCTCTACTTGAGGAGCTTGTTGGATCTGGAGGAGAAAGGCAGCCAACTGACA
CAGAAGTTCAAGCAGCAGTATGGGAGGCTTGTGGAGATTCTGGAGCTTTACAACTTCTTGTTGATCTGCTTAACATGAAGATGATGGATC
TGGAAGAGGGTTCAGGAACAGAGGAGAATGACACTGAATTACTCGAGAAAGCTCGCACTGCAGAAACCTCACAAGATTGCAAAGAGTATG
ATCAAAAXACTACTATAGTTACCAACATGGAAATAGCATGCAGGTTTAACTTTGTTAATACTAACTTTACTGCCGATCCAGGACCAGTGA
CATTGcCCAGAATCATTTGCTGaGTAGAAATAAGCAATCTAGTATAATATACAGGCGGGGGCAGAAACAACTAACTCGTCTCTTCATTAA
GGAAGCAGAGCACGCGTTGCAGTTAGCATTGACCGAAGAAXCTCTAGATAAATCTAACCCAAGATTTTACATTCTGCAAGATAGCTATTT
GAGCAAATATTTAGGTAATGATTGA(3')AATGTCAAGCCGGGCCTGCATTTCAGGTAAGCATTTTCTGACGGAATCTAAATGTATACCC
AAGTTGGGACGATTCATGCTGGCTATTTAAGCAAAGGTTTTGGCAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan