ESTScan Details for Unigene SGN-U326237

Score 
484
Direction 
Forward
Predicted Peptide Sequence 
VFNLLRSGFRESLDQLIQSYVERQGRSPIDWDLHRNLPIPVSPEMGPDQHNDDQNDDQQDGVGRPSIVLPSPPVPPPXATLASGFASLKL
ATSPVHRSELEWEMINELRADMARLQQGMNHMQRMLESCMDMQLELQRSVRQEVSAALNRSAGGQGAAETSVDGSKWGNVKKGTCCVCCD
SHIDSLLYRYESYFAILMKS
Predicted Coding Sequence 
GTTTTCAACCTTCTTCGCAGTGGTTTCCGTGAAAGTTTAGATCAATTAATTCAGTCATATGTGGAAAGGCAAGGGCGCTCTCCTATTGAT
TGGGATCTGCATCGGAACTTGCCTATTCCTGTTTCACCTGAAATGGGTCCAGACCAGCATAATGATGACCAAAATGATGATCAGCAGGAT
GGAGTTGGGCGGCCTTCAATTGTACTACCCTCTCCTCCTGTGCCACCACCCCAXGCCACTTTGGCATCAGGATTTGCATCACTCAAGTTG
GCCACGTCACCAGTGCATCGTTCTGAACTTGAGTGGGAAATGATTAATGAACTTAGAGCAGACATGGCAAGACTGCAGCAAGGCATGAAC
CACATGCAAAGAATGTTAGAATCCTGCATGGATATGCAACTGGAGCTACAACGCTCTGTCAGGCAGGAAGTTTCAGCTGCTTTGAATCGA
TCAGCTGGTGGTCAAGGGGCTGCAGAGACCTCAGTCGATGGTTCTAAGTGGGGCAACGTGAAAAAGGGTACTTGCTGTGTTTGTTGTGAT
AGTCACATCGACTCCTTGTTGTACAGGTACGAGTCATATTTTGCAATTTTAATGAAATCTTAA
Edits in Original Sequence 
(5')GTTTTCAACCTTCTTCGCAGTGGTTTCCGTGAAAGTTTAGATCAATTAATTCAGTCATATGTGGAAAGGCAAGGGCGCTCTCCTAT
TGATTGGGATCTGCATCGGAACTTGCCTATTCCTGTTTCACCTGAAATGGGTCCAGACCAGCATAATGATGACCAAAATGATGATCAGCA
GGATGGAGTTGGGCGGCCTTCAATTGTACTACCCTCTCCTCCTGTGCCACCACCCCAXGCCACTTTGGCATCAGGATTTGCATCACTCAA
GTTGGCCACGTCACgCAGTGCATCGTTCTGAACTTGAGTGGGAAATGATTAATGAACTTAGAGCAGACATGGCAAGACTGCAGCAAGGCA
TGAACCACATGCAAAGAATGTTAGAATCCTGCATGGATATGCAACTGGAGCTACAACGCTCTGTCAGGCAGGAAGTTTCAGCTGCTTTGA
ATCGATCAGCTGGTGGTCAAGGGGCTGCAGAGACCTCAGTCGATGGTTCTAAGTGGGGCAACGTGAAAAAGGGTACTTGCTGTGTTTGTT
GTGATAGTCACATCGACTCCTTGTTGTACAGGTACGAGTCATATTTTGCAATTTTAATGAAATCTTAA(3')CTGGATTCAACTTATGTA
ATGCCAATAGTGTATATAATTTCCCATTATTAATTCATTTAACCTGTTTTACCTATAACCAGCCTTTTCTCGCCTAGGCTACTAATCCCA
CCGATCTTTTTATATATAGTGATCTAATCACGATATATAGTTTTGAGTAAATGAAATCAATAGTTTAAATGTATTTTCCTCCAATTGACA
GATGTGGGCACATGTGCACTTGTTCAAAATGTGCAAATGAATTGGTGAGAGGCGGAAGGAAGTGTCCGTTGTGTCGCGCACCCATTGTTG
AGGTGATACGAGCTTACTCAATACTGTAAAAAAAAGAAAAAAGTCGAAAGGGATAGGAGGGTGAAGAGAGAAGGTTGGTAAGGTAGGTGT
AAGAGGAGTTGTAATGCTCCCTCTACCAAGCTTCTGTTATTCTGTAGAGTGTTTATTTACTTTTGCCCATCTTCTTCGAATTATATATTA
TGGAATGCTATGCAAATGTGTAATTGGAAAAACGAAAGGCACTTTTTTTGCATCATTCATTCGTAAATAAAATTCTTTTTTATTTAACCA
AAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan