ESTScan Details for Unigene SGN-U326269

Score 
742
Direction 
Forward
Predicted Peptide Sequence 
PNVWPVSGSNTGRXWRNPAYTAVRFIFTTFIALVFGTMFWDLGTKVSRSQDLINAMGSMYAATLFLGVQNSSSVQPVVAVERTVFYREKA
AGMYSAIPYAFGQVVIEIPYVFVQSAFYGVIVYAMIGFEWTAVKFLWYFFFMYCTLLYFTFYGMMTVAVTPNQNVASIVAAFFYAVWNLF
SGFIVPRPRIPIWWRWYYWACPVAWTLYGLVASQFGDIQTPLTDDENVEQYLRRYFGFKHDFLGVVAAVIVALPVMFALTFALGIKAFNF
QRR
Predicted Coding Sequence 
CCCAATGTATGGCCTGTCTCTGGAAGCAACACTGGTCGTXACTGGCGTAATCCAGCTTATACTGCAGTTAGATTCATTTTCACAACATTC
ATAGCACTTGTCTTTGGCACAATGTTTTGGGATCTTGGTACCAAAGTGAGTCGGAGTCAGGATCTTATCAACGCTATGGGATCTATGTAT
GCTGCAACTCTCTTCCTTGGTGTACAAAATTCATCATCTGTCCAGCCTGTTGTAGCCGTTGAACGTACTGTATTTTACAGAGAAAAAGCT
GCTGGAATGTATTCTGCCATACCTTACGCCTTTGGACAGGTTGTCATCGAAATACCTTATGTATTTGTACAATCAGCTTTCTATGGTGTC
ATCGTGTATGCAATGATCGGGTTTGAATGGACTGCTGTCAAATTCTTATGGTACTTCTTCTTCATGTACTGCACCCTCTTGTACTTCACC
TTCTACGGCATGATGACAGTGGCTGTTACTCCAAACCAAAACGTTGCATCCATTGTCGCGGCCTTCTTCTATGCAGTATGGAATCTCTTC
TCAGGATTCATCGTTCCACGACCTCGTATTCCAATCTGGTGGAGATGGTACTACTGGGCTTGCCCTGTTGCATGGACCTTGTATGGTCTC
GTTGCATCACAATTCGGAGACATCCAAACTCCTCTCACCGATGATGAAAATGTTGAACAATACTTAAGACGTTACTTCGGATTCAAACAT
GATTTCCTTGGCGTTGTTGCTGCTGTGATCGTCGCGTTGCCTGTTATGTTTGCGTTGACATTTGCATTAGGCATTAAGGCCTTCAACTTC
CAGAGAAGATAA
Edits in Original Sequence 
(5')CCCAATGTATGGCCTGTCTCTGGAAGCAACACTGGTCGTXACTGGCGTAATCCAGCTTATACTGCAGTTAGATTCATTTTCACAAC
ATTCATAGCACTTGTCTTTGGCACAATGTTTTGGGATCTTGGTACCAAAGTGAGTCGGAGTCAGGATCTTATCAACGCTATGGGATCTAT
GTATGCTGCAACTCTCTTCCTTGGTGTACAAAATTCATCATCTGTCCAGCCTGTTGTAGCCGTTGAACGTACTGTATTTTACAGAGAAAA
AGCTGCTGGAATGTATTCTGCCATACCTTACGCCTTTGGACAGGTTGTCATCGAAATACCTTATGTATTTGTACAATCAGCTTTCTATGG
TGTCATCGTGTATGCAATGATCGGGTTTGAATGGACTGCTGTCAAATTCTTATGGTACTTCTTCTTCATGTACTGCACCCTCTTGTACTT
CACCTTCTACGGCATGATGACAGTGGCTGTTACTCCAAACCAAAACGTTGCATCCATTGTCGCGGCCTTCTTCTATGCAGTATGGAATCT
CTTCTCAGGATTCATCGTTCCACGACCTCGTATTCCAATCTGGTGGAGATGGTACTACTGGGCTTGCCCTGTTGCATGGACCTTGTATGG
TCTCGTTGCATCACAATTCGGAGACATCCAAACTCCTCTCACCGATGATGAAAATGTTGAACAATACTTAAGACGTTACTTCGGATTCAA
ACATGATTTCCTTGGCGTTGTTGCTGCTGTGATCGTCGCGTTGCCTGTTATGTTTGCGTTGACATTTGCATTAGGCATTAAGGCCTTCAA
CTTCCAGAGAAGATAA(3')AAGACACAACAAACTGTGTATATTGATCACAACTTTGAAGAGCTTTTTGAAAAATTTTCTGTGTATTTTT
TACCTTATTGAAAATTCATTCTAAGTTTTGTGTAAGAAATAATTAGTATATAAATGATATTATATTTTTTTACCGAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan