ESTScan Details for Unigene SGN-U326347

Score 
126
Direction 
Forward
Predicted Peptide Sequence 
RDAVEPVLLNLSIRLRNLQECMNEKIRANAYAAFGALSTYGSGPQQDSFLEQAHAAFPRMVLHLHEDDLSGDKLAEKFNLPDFFFLYCSG
WLYELTLQXRQNTLKSIAPLMEIDGITAVFNSHWFSSDHRYEPIXLDQSLMVIHENDIELPSIFRGDYEDFLRELARQLTQNLAARVDRY
MASKYRSVFFFLILHLEKL
Predicted Coding Sequence 
AGGGATGCAGTTGAACCTGTTCTCCTGAACCTTTCTATACGTCTTCGGAATCTCCAAGAGTGCATGAATGAGAAGATACGAGCCAATGCT
TATGCGGCATTTGGAGCACTGAGCACTTACGGATCTGGGCCTCAGCAAGACTCTTTTCTTGAGCAGGCTCATGCTGCTTTCCCACGGATG
GTTTTACATCTACATGAGGATGATCTTAGTGGAGACAAGCTTGCCGAGAAGTTTAATCTGCCAGATTTTTTTTTCTTATATTGTTCAGGA
TGGCTTTATGAGTTAACTCTTCAACAXCGCCAGAACACTTTGAAATCCATTGCTCCCTTGATGGAAATTGATGGAATAACTGCTGTTTTC
AACAGTCACTGGTTTAGTTCGGACCATCGGTATGAACCCATTGXACTTGATCAGTCCTTAATGGTTATTCATGAGAATGATATTGAGTTG
CCTTCAATTTTTAGAGGCGACTATGAAGACTTTCTTCGAGAACTTGCAAGGCAACTAACTCAAAATCTTGCTGCCCGAGTAGATAGGTAC
ATGGCATCAAAATACAGGTCCGTATTCTTTTTTCTAATCTTGCATTTGGAGAAACTTTGA
Edits in Original Sequence 
(5')AGGGATGCAGTTGAACCTGTTCTCCTGAACCTTTCTATACGTCTTCGGAATCTCCAAGAGTGCATGAATGAGAAGATACGAGCCAA
TGCTTATGCGGCATTTGGAGCACTGAGCACTTACGGATCTGGGCCTCAGCAAGACTCTTTTCTTGAGCAGGCTCATGCTGCTTTCCCACG
GATGGTTTTACATCTACATGAGGATGATCTTAGTGtGAGACAAGCTTGCCGAGtAAGTTTAATCTGCCAGATTTTTTTTTCTTATATTGT
TCAGGATGGCTTTATGAGTTAACTCTTCAACAXCGCCAGAACACTTTGAAATCCATTGCTCCCTTGATGGAAATTGATGGAATAACTGCT
GTTTTCAACAGTCACTGGTTTAGTTCGGACCATCGGTATGAACCCATTGXACTTGATCAGTCCTTAATGGTTATTCATGAGtAATGATAT
TGAGTTGCCTTCAATTTTTAGAGGCGACTATGAAGACTTTCTTCGAGAACTTGCAAGGCAACTAACTCAAAATCTTGCTGCCCGAGTAGA
TAGGTACATGGCATCAAtAATACAGGTCCGTATTCTTTTTTCTAATCTTGCATTTGGAGAAACTTTGA(3')AGGTATGCATGTCTTTGT
ATTGAAATGCCATTAAATTCAGCGCTATGATGAAATTGGTACGAGAAAAAAAAGTTATGAATTTCCTACCATTCAAAAGTAAACGCAGTT
CCCCTAAGAAGCTGGTGGGTTTCATAGAATCATATTCATACTAAAATAGCTGTCAAATTTTGGTGTTATAAAATTTTCAAGTGCTTGAAT
TTCCGAATCTTCAGAAAGTAGTAGTAGGCATACTTCCATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan