ESTScan Details for Unigene SGN-U326373

Score 
812
Direction 
Forward
Predicted Peptide Sequence 
VYTALVNAYPLSGLLDEALRTIDDMKSVSNCKPDVYTYSILIKCCTKVRRFDMIEYILAEMVYLGIECSSVTYNTIIDGYGKAKLFEQME
CSLTDMIENETAFPDVFTLNSVIGSYGSCGKLEEMEKWFEEFQVMGIKPDVMTFNILIKSYGRAGMYQKMECVLDFMRNWFYSPTVVTYN
IIIETLGKACLIKNMEQFFLQMKHEGVKPSSFTYCSLVSAYSRAALMENVDSIMRQVENSDVVLDTPFFNCIISAYGQVGDIERMVALFL
EMKVRKCKPDYITFSTMIQAYNSQGMTEAAMDLKTEMITSCESNEXDQQQYNLSATEGNRSLGILFINLNVVKVGRVLSACELKDDIEIR
Predicted Coding Sequence 
XATGTTTATACTGCACTTGTAAATGCATATCCTCTTAGTGGCCTCCTTGATGAGGCTCTGCGAACTATTGATGATATGAAATCAGTTAGT
AATTGCAAGCCTGATGTGTATACTTACTCGATCCTAATTAAATGCTGCACTAAAGTTCGTCGTTTTGATATGATTGAATACATTTTGGCT
GAGATGGTGTATTTGGGAATTGAATGTAGTTCTGTGACATACAATACCATAATTGATGGCTATGGTAAAGCTAAGCTATTTGAGCAGATG
GAATGCTCCTTGACCGATATGATAGAAAATGAGACTGCCTTTCCAGATGTTTTCACCTTGAATTCAGTAATTGGGTCCTATGGCAGCTGT
GGGAAGCTTGAGGAAATGGAGAAGTGGTTTGAAGAATTTCAGGTAATGGGAATAAAGCCAGATGTTATGACATTTAACATTTTAATCAAG
TCATATGGAAGAGCTGGCATGTACCAGAAAATGGAGTGTGTACTTGATTTCATGAGGAATTGGTTCTATTCTCCAACAGTTGTGACTTAC
AATATCATCATTGAGACATTGGGGAAAGCTTGCCTCATTAAGAACATGGAACAGTTTTTCCTACAGATGAAGCATGAAGGGGTGAAGCCA
AGTTCATTCACTTATTGCTCTCTTGTCAGTGCGTATAGTAGAGCTGCACTTATGGAAAATGTTGATTCAATCATGAGGCAAGTTGAGAAT
TCAGATGTAGTTCTAGATACTCCTTTTTTCAATTGCATCATCAGTGCTTACGGTCAAGTTGGTGATATAGAGAGGATGGTGGCATTGTTC
TTGGAAATGAAGGTCAGAAAATGTAAACCAGACTACATCACATTTTCTACCATGATTCAGGCGTACAATTCACAAGGAATGACTGAAGCT
GCAATGGACTTGAAGACAGAAATGATTACTTCTTGTGAATCAAATGAAXTTGATCAGCAGCAGTACAATCTATCTGCTACCGAAGGGAAC
CGTTCACTTGGAATTCTGTTCATCAATCTCAATGTTGTGAAAGTGGGCAGAGTGTTATCTGCATGTGAGCTTAAGGATGATATAGAAATC
CGTTAA
Edits in Original Sequence 
(5')XATGTTTATACTGCACTTGTAAATGCATATCCTCTTAGTGGCCTCCTTGATGAGGCTCTGCGAACTATTGATGATATGAAATCAGT
TAGTAATTGCAAGCCTGATGTGTATACTTACTCGATCCTAATTAAATGCTGCACTAAAGTTCGTCGTTTTGATATGATTGAATACATTTT
GGCTGAGATGGTGTATTTGGGAATTGAATGTAGTTCTGTGACATACAATACCATAATTGATGGCTATGGTAAAGCTAAGCTATTTGAGCA
GATGGAATGCTCCTTGACCGATATGATAGAAAATGAGACTGCCTTTCCAGATGTTTTCACCTTGAATTCAGTAATTGGGTCCTATGGCAG
CTGTGGGAAGCTTGAGGAAATGGAGAAGTGGTTTGAAGAATTTCAGGTAATGGGAATAAAGCCAGATGTTATGACATTTAACATTTTAAT
CAAGTCATATGGAAGAGCTGGCATGTACCAGAAAATGGAGTGTGTACTTGATTTCATGAGGAATTGGTTCTATTCTCCAACAGTTGTGAC
TTACAATATCATCATTGAGACATTGGGGAAAGCTTGCCTCATTAAGAACATGGAACAGTTTTTCCTACAGATGAAGCATGAAGGGGTGAA
GCCAAGTTCATTCACTTATTGCTCTCTTGTCAGTGCGTATAGTAGAGCTGCACTTATGGAAAATGTTGATTCAATCATGAGGCAAGTTGA
GAATTCAGATGTAGTTCTAGATACTCCTTTTTTCAATTGCATCATCAGTGCTTACGGTCAAGTTGGTGATATAGAGAGGATGGTGGCATT
GTTCTTGGAAATGAAGGTCAGAAAATGTAAACCAGACTACATCACATTTTCTACCATGATTCAGGCGTACAATTCACAAGGAATGACTGA
AGCTGCAATGGACTTGAAGACAGAAATGATTACTTCTTGTGAATCAAATGAAXTTGATCAGCAGCtAGTACAATCTATCTGCTACCGAAG
GGAACCGTTCACTTGGAATTCTGTTCATCAATCTCAATGTTGTGAAAGTGGGCAGAGTGTTATCTGCATGTGAGCTTAAGGATGATATAG
AAATCCGTTAA(3')TCAGATGGCATGGATCCAAGGAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan