ESTScan Details for Unigene SGN-U326410

Score 
667
Direction 
Forward
Predicted Peptide Sequence 
SLQGEIPFSGPFKNLSSLSFMFNEALCGAPRFHVPSCPTSSNHRSKRKKLLLIVFPLLGAAVTIVFVTLAFVWMRYRKEGNVPVQADLLA
TRERISYYEIIQATNDFSESNFIGSGSFGSVYKGILINGTIIAVKVFNLQVEGAFKSFETECEVLRNLRHRNLTKVISSCSNLDFKALVL
EYMPNGSLEKWLYSHNYFLDILQRLSIMIDVACALEYLHHG
Predicted Coding Sequence 
XACAGCTTGCAGGGTGAAATTCCTTTTAGTGGTCCTTTCAAGAACCTTTCCAGCCTGTCATTCATGTTCAATGAAGCATTGTGTGGTGCT
CCAAGATTTCATGTCCCTTCGTGCCCCACTTCTTCAAACCATAGATCAAAGAGGAAGAAGTTACTTCTGATAGTCTTTCCTCTACTCGGA
GCTGCTGTGACAATTGTTTTTGTAACATTGGCATTTGTGTGGATGAGGTACAGAAAAGAAGGAAATGTTCCAGTCCAAGCTGATTTGTTA
GCTACAAGGGAAAGAATTTCATACTATGAAATCATACAAGCCACAAATGATTTTAGTGAGAGTAATTTCATTGGTTCAGGGAGTTTTGGT
TCTGTTTACAAAGGAATTCTCATAAATGGGACTATCATTGCAGTTAAAGTGTTCAACCTACAAGTTGAAGGTGCATTCAAGAGTTTTGAA
ACAGAATGTGAAGTTCTTCGCAACCTTCGCCATAGGAATCTCACCAAAGTCATTAGCAGTTGCTCCAACCTTGATTTCAAGGCTTTAGTG
CTCGAGTACATGCCTAATGGGAGCCTTGAAAAGTGGTTGTATTCACACAACTACTTCTTAGACATCCTTCAAAGACTAAGCATAATGATT
GATGTGGCATGTGCATTGGAATATCTCCACCATGGT
Edits in Original Sequence 
(5')XACAGCTTGCAGGGTGAAATTCCTTTTAGTGGTCCTTTCAAGAACCTTTCCAGCCTGTCATTCATGTTCAATGAAGCATTGTGTGG
TGCTCCAAGATTTCATGTCCCTTCGTGCCCCACTTCTTCAAACCATAGATCAAAGAGGAAGAAGTTACTTCTGATAGTCTTTCCTCTACT
CGGAGCTGCTGTGACAATTGTTTTTGTAACATTGGCATTTGTGTGGATGAGGTACAGAAAAGAAGGAAATGTTCCAGTCCAAGCTGATTT
GTTAGCTACAAGGGAAAGAATTTCATACTATGAAATCATACAAGCCACAAATGATTTTAGTGAGAGTAATTTCATTGGTTCAGGGAGTTT
TGGTTCTGTTTACAAAGGAATTCTCATAAATGGGACTATCATTGCAGTTAAAGTGTTCAACCTACAAGTTGAAGGTGCATTCAAGAGTTT
TGAAACAGAATGTGAAGTTCTTCGCAACCTTCGCCATAGGAATCTCACCAAAGTCATTAGCAGTTGCTCCAACCTTGATTTCAAGGCTTT
AGTGCTCGAGTACATGCCTAATGGGAGCCTTGAAAAGTGGTTGTATTCACACAACTACTTCTTAGACATCCTTCAAAGACTAAGCATAAT
GATTGATGTGGCATGTGCATTGGAATATCTCCACCATGGT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan