ESTScan Details for Unigene SGN-U326428

Score 
86
Direction 
Reverse
Predicted Peptide Sequence 
SDFCDSKCNVRCSKAGRQDRCLKYCGICCEECHCLPSGTYGHKDECPCYRDKKNSKGGPKCP
Predicted Coding Sequence 
XGTTCAGATTTTTGTGATTCAAAGTGTAACGTAAGGTGTTCAAAAGCAGGACGACAAGACAGATGCTTAAAGTACTGTGGAATATGTTGT
GAGGAGTGTCATTGCCTTCCTTCTGGAACTTATGGGCATAAAGATGAGTGCCCTTGCTATAGAGACAAGAAGAACTCTAAGGGAGGGCCT
AAATGCCCTTGA
Edits in Original Sequence 
(5')XGTTCAGATTTTTGTGATTCAAAGTGTAACGTAAGGTGTTCAAAAGCAGGACGACAAGACAGATGCTTAAAGTACTGTGGAATATG
TTGTGAGGAGTGTCATTGCCTTCCTTCTGGAACTTATGGGCATAAAGATGAGTGCCCTTGCTATAGAGACAAGAAGAACTCTAAGGGAGG
GCCTAAATGCCCTTGA(3')ATTTACTTACTCTTTAGTATTTACCCCAATTGTTGTTTGTAAAAATCAAAAACAGAAATGATTATTATGA
AAAAAAAATTAAGTGAACAAATGGGGTTCTTTTGAATATTTTATATTATGTTATTGTTAAATCCATCGAGCTTTTACAGCTTGTTTGAAT
ACTTGTTACCTATGGTATTGTAAGCTATTCGTTTTTGAAATATAATAACTATTTTGTTTTGATTATTAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan