ESTScan Details for Unigene SGN-U326509

Score 
193
Direction 
Forward
Predicted Peptide Sequence 
LSLRGNVEDVVVKSTPPAGTLGYLDPAYLAPSDLSTKSDVFSYGILLLEIISGRNAIDVNYSPPSVVDWAVPLIKSGEYSEIYDPRLTSP
EDDEALRQLAIVAARCVRKTAAKRPAMAEVVEWLKQVYKRMSSPIWNNIXAASGACEGINAVVKYEPLDESMEIVKISRMGSRRNRKVSN
VATTELESAVIGQKIKPVIRSKSIGSLGEIASEPFDLANNYYNQTVRRKGGLAVKMPTVRLSKSRSMGMIQSSTRLMNKSNSNGIVVKFV
KKPNGKELEESKLLVDVGKELASFENSSKN
Predicted Coding Sequence 
TTGTCTTTGAGAGGAAATGTTGAAGACGTCGTCGTTAAAAGTACGCCGCCGGCGGGTACGTTGGGGTATTTGGATCCTGCTTATCTAGCA
CCCAGTGATCTCAGTACTAAATCTGACGTTTTCAGCTATGGGATCTTGTTATTAGAGATCATTAGTGGCCGGAATGCAATCGACGTGAAT
TACAGTCCGCCGTCAGTGGTGGATTGGGCTGTACCGTTGATTAAATCCGGCGAGTATTCAGAGATTTATGACCCTAGACTCACCTCACCG
GAGGACGACGAAGCTTTACGACAGCTAGCTATAGTCGCAGCGCGTTGCGTCCGTAAGACGGCGGCGAAACGGCCGGCGATGGCGGAGGTG
GTGGAGTGGTTAAAACAGGTGTATAAACGAATGAGCTCACCAATATGGAATAACATAGXGGCGGCGAGTGGGGCGTGTGAGGGAATCAAC
GCGGTGGTGAAATATGAGCCGTTGGATGAAAGTATGGAAATAGTTAAGATCTCTAGAATGGGAAGTAGAAGAAATAGGAAAGTATCCAAT
GTGGCGACCACAGAATTAGAAAGTGCTGTGATTGGTCAAAAAATAAAACCAGTAATTAGATCGAAATCTATTGGCTCACTTGGTGAGATT
GCATCTGAACCGTTTGATTTGGCTAATAACTATTATAATCAGACGGTTAGGAGGAAAGGAGGATTGGCTGTGAAGATGCCTACAGTAAGG
TTGAGTAAGTCAAGATCAATGGGGATGATTCAAAGTAGTACAAGGTTAATGAACAAGAGTAATAGTAATGGGATTGTGGTTAAGTTTGTA
AAAAAACCAAATGGAAAAGAATTAGAGGAGTCTAAATTGCTAGTTGATGTAGGAAAAGAACTCGCTTCATTCGAAAACAGTTCTAAAAAT
TAA
Edits in Original Sequence 
(5')TTGTCTTTGAGAGGAAATGTTGAAGACGTCGTCGTTAAAAGTACGCCGCCGGCGGGTACGTTGGGGTATTTGGATCCTGCTTATCT
AGCACCCAGTGATCTCAGTACTAAATCTGACGTTTTCAGCTATGGGATCTTGTTATTAGAGATCATTAGTGGCCGGAATGCAATCGACGT
GAATTACAGTCCGCCGTCAGTGGTGGATTGGGCTGTACCGTTGATTAAATCCGGCGAGTATTCAGAGATTTATGACCCTAGACTCACCTC
ACCGGAGGACGACGAAGCTTTACGACAGCTAGCTATAGTCGCAGCGCGTTGCGTCCGTAAGACGGCGGCGAAACGGCCGGCGATGGCGGA
GGTGGTGGAGTGGTTAAAACAGGTGTATAAACGAATGAGCTCACCAATATGGAATAACATAGXGGCGGCGAGTGGGGCGTGTGAGGGAAT
CAACGCGcGTGGTGAAATATGAGCCGTTGGATGAAAGTATGGAAATAGTTAAGATCTCTAGAATGGGAAGTAGAAGAAATAGGAAAGTAT
CCAATGTGGCGACCACAGAATTAGAAAGTGCTGTGATTGGTCAAAAAATAAAACCAGTAATTAGATCGAAATCTATTGGCTCACTTGGTG
AGATTGCATCTGAACCGTTTGATTTGGCTAATAACTATTATAATCAGACGGTTAGGAGGAAAGGAGGATTGGCTGTGAAGATGCCTACAG
TAAGGTTGAGTAAGTCAAGATCAATGGGGATGATTCAAAGTAGTACAAGGTTAATGAACAAGAGTAATAGTAATGGGATTGTGGTTAAGT
TTGTAAAAAAACCAAATGGAAAAGAATTAGAGGAGTCTAAATTGCTAGTTGATGTAGGAAAAGAACTCGCTTCATTCGAAAACAGTTCTA
AAAATTAA(3')GGGTAAGAAATACGTACACTCAATTCTTCTGAAATCTTATTTATGAGATTTCACTCGATGTGAAAAGATCTCCAAAGG
GGGATAGTAATTGATTGTATTATCAATTTTTTCTTGTTGTATTATTCATTTCCTTGCCTTTTTAAAAAAAAAAAGAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan