ESTScan Details for Unigene SGN-U326544

Score 
534
Direction 
Forward
Predicted Peptide Sequence 
MSFFCFSFLLSLFIFPSASQSLRGVLIDCGAVVDSVVNEQNWVSDYGYVSAGKPKNLTVDVLDYTLSTVRTFPLKNNVFKKFCYEVPVYR
GGKYLVRTTYFYGGVNGNLNPPVFDQIVDGTFWSPVNTTEDYWKGMSSYYEGIFKAVGKTMSVCLAANSLTDSDPFISALELVLVSDSLY
NSTDFNXLWIDFDYNEQFWEQWINYX
Predicted Coding Sequence 
ATGTCTTTCTTCTGTTTCTCCTTCCTTCTTTCCCTTTTTATCTTCCCTTCTGCTTCACAATCCTTAAGAGGTGTTTTGATTGATTGTGGT
GCTGTGGTTGATTCTGTAGTTAATGAGCAAAATTGGGTTTCGGATTATGGTTATGTATCAGCAGGAAAACCCAAGAATCTTACAGTTGAT
GTTCTTGATTATACACTTTCAACAGTCCGTACATTTCCATTGAAGAACAATGTTTTCAAGAAATTCTGTTATGAGGTTCCTGTTTATCGT
GGAGGGAAGTATTTGGTCAGGACGACGTATTTCTATGGTGGGGTTAATGGGAATTTGAATCCACCTGTGTTTGATCAGATTGTTGATGGG
ACTTTTTGGAGTCCAGTGAATACAACTGAGGATTATTGGAAGGGGATGTCTTCATATTATGAAGGGATTTTCAAGGCTGTAGGGAAGACT
ATGAGTGTGTGTTTGGCTGCTAATAGTTTAACGGATTCTGACCCTTTTATATCTGCTTTGGAGCTTGTTTTGGTGTCGGATTCGTTGTAT
AATTCTACAGATTTTAATXATTTATGGATTGACTTTGATTACAACGAGCAGTTTTGGGAACAATGGATCAATTATCXX
Edits in Original Sequence 
AAAGTGAAGCAAGCTGACCTGGTTCATTCCCGCGTCCCTTCTCCCAAAAAACAATGGCATTAATCCAACTTTGATTCTTTCCTCTTCAAC
AACTTCACCTCTCATTCTCCAAATTTTCTATTCTTTTCTTCCTTTAACTCACCCAAACGACTCATTCAACTCCACTCCACCTAATATCAA
CCTTTTTTTCCCTTCTCAAAATCATCACATGACTCTCTGTTTCTTCAATCATCACCATTAACC
(5')ATGTCTTTCTTCTGTTTCTCCTT
CCTTCTTTCCCTTTTTATCTTCCCTTCTGCTTCACAATCCTTAAGAGGTGTTTTGATTGATTGTGGTGCTGTGGTTGATTCTGTAGTTAA
TGAGCAAAATTGGGTTTCGGATTATGGTTATGTATCAGCAGGAAAACCCAAGAATCTTACAGTTGATGTTCTTGATTATACACTTTCAAC
AGTCCGTACATTTCCATTGAAGAACAATGTTTTCAAGAAATTCTGTTATGAGGTTCCTGTTTATCGTGGAGGGAAGTATTTGGTCAGGAC
GACGTATTTCTATGGTGGGGTTAATGGGAATTTGAATCCACCTGTGTTTGATCAGATTGTTGATGGGACTTTTTGGAGTCCAGTGAATAC
AACTGAGGATTATTGGAAGGGGATGTCTTCATATTATGAAGGGATTTTCAAGGCTGTAGGGAAGACTATGAGTGTGTGTTTGGCTGCTAA
TAGTTTAACGGATTCTGACCCTTTTATATCTGCTTTGGAGCTTGTTTTGGTGTCGGATTCGTTGTATAATTCTACAGATTTTAATXATTT
ATGGATTGACTTTGATTACAACGAGCAGTTTTGGGAACAATGGATCAATTATCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan