ESTScan Details for Unigene SGN-U326635

Score 
262
Direction 
Forward
Predicted Peptide Sequence 
MAISKFLLVTMVLISLLVFRPVEANGNGDGDNLAVHTAGPEGANNPTYIPTSECGTACEARCSLASRHKMCLRACGTCCTRCNCVPPGTS
GNQDLCPCYRDMLTHHGKHKCP
Predicted Coding Sequence 
ATGGCCATCTCCAAATTTCTTCTTGTTACTATGGTTTTGATTTCTCTACTTGTTTTTCGTCCTGTGGAAGCTAATGGCAACGGTGACGGT
GACAATTTAGCGGTGCACACGGCTGGACCAGAGGGTGCTAACAACCCTACTTACATCCCTACATCAGAGTGTGGAACAGCATGTGAGGCA
AGATGTAGTCTAGCATCAAGACATAAAATGTGTTTGAGAGCATGTGGGACTTGTTGCACTCGTTGTAATTGTGTGCCTCCAGGCACCTCT
GGGAACCAAGATCTTTGCCCTTGTTACCGTGACATGCTCACTCATCATGGCAAGCACAAGTGTCCCTAA
Edits in Original Sequence 
TAAAAGTTTATTTTAATGTGTGTTAGCC(5')ATGGCCATCTCCAAATTTCTTCTTGTTACTATGGTTTTGATTTCTCTACTTGTTTTTC
GTCCTGTGGAAGCTAATGGCAACGGTGACGGTGACAATTTAGCGGTGCACACGGCTGGACCAGAGGGTGCTAACAACCCTACTTACATCC
CTACATCAGAGTGTGGAACAGCATGTGAGGCAAGATGTAGTCTAGCATCAAGACATAAAATGTGTTTGAGAGCATGTGGGACTTGTTGCA
CTCGTTGTAATTGTGTGCCTCCAGGCACCTCTGGGAACCAAGATCTTTGCCCTTGTTACCGTGACATGCTCACTCATCATGGCAAGCACA
AGTGTCCCTAA(3')ATATATATATATATATATATATACTTATACATAGTAATATATGTATAACATAAAACTTTTTAAGAAGTGATCAAA
AATAAAACGCGATAAATTTTAGATGATTTTTAGATATTTTATTTAATTTTTTATCGGCTTGAAAATTTGCGATTTCTTTTGTATCGACCT
ATATGCGCGATCGCGTGTTCTAGATGATAAATGTCACTCGTGTAGTCCCTATAAAAAAAAAAAAAAAAAAAAAAAAAAACTTTTGGGGGG
GGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan