ESTScan Details for Unigene SGN-U326665

Score 
870
Direction 
Forward
Predicted Peptide Sequence 
MGRCLSVQSSNPTELKFQTLNGIHQLAEVVDXKAWFLDQFGVLHDGKHPYPGAISALEKLATYGAKMVIISNSSRRASTTLEKLRSLGFD
PSLFIGAITSGELTHQYLQTRDDAWFASIGRSCIHMTWSDRGAISLEGLGLEVVEKVEEADFILAHGTEALGLSSGAAVPMNLDELEKIL
DQCAAKKIPMVVANPDFVTVEARSLRVMPGTLAATYEKLGGEVKWMGKPDKIIYKSAMEMASVVDASDCVAIGDSLHHDIKGANVAGIAS
AFITGGIHAAELGLGKFGEVVDDDNVHALALASNAYPTYVLPSFTW
Predicted Coding Sequence 
ATGGGAAGATGCTTATCAGTTCAATCATCAAACCCAACCGAACTTAAATTTCAAACTTTGAATGGAATTCATCAACTAGCTGAAGTTGTT
GATXTCAAGGCATGGTTTCTGGATCAGTTTGGTGTGCTTCATGATGGGAAACATCCCTATCCTGGTGCCATTTCGGCCTTGGAAAAGTTG
GCAACTTATGGTGCAAAGATGGTAATCATTAGTAATTCTTCGAGAAGAGCATCCACAACCCTGGAAAAATTGAGGAGCCTTGGATTTGAC
CCGTCGCTCTTTATTGGTGCAATCACGAGTGGTGAATTAACACATCAGTATCTTCAAACGAGAGATGACGCTTGGTTTGCCTCAATAGGA
AGATCGTGTATTCACATGACTTGGAGTGACAGGGGTGCTATATCTCTTGAAGGCCTCGGACTAGAAGTTGTAGAGAAGGTTGAGGAAGCT
GATTTTATTTTGGCTCACGGAACTGAAGCCTTGGGGCTTTCTTCTGGTGCCGCAGTTCCTATGAATCTTGATGAACTTGAAAAGATACTG
GATCAGTGTGCTGCTAAGAAAATCCCCATGGTAGTAGCAAATCCTGATTTTGTAACCGTTGAAGCTAGATCTCTGCGTGTTATGCCTGGA
ACATTGGCAGCCACGTATGAGAAACTTGGCGGTGAAGTGAAATGGATGGGTAAACCTGATAAGATAATATACAAGTCAGCTATGGAAATG
GCTTCTGTTGTGGATGCCTCCGATTGTGTAGCTATAGGGGACTCCCTTCACCATGATATCAAAGGCGCAAATGTAGCTGGAATTGCTTCA
GCGTTTATCACAGGCGGAATACATGCTGCTGAACTTGGACTTGGAAAATTCGGAGAAGTCGTGGATGATGATAATGTACATGCTCTTGCC
TTGGCAAGCAATGCATATCCTACATATGTGCTGCCTTCATTTACTTGG
Edits in Original Sequence 
GACTTTCAGCTGGCTGGTTACAACTTCAGCAGTCGTGTTGTGTGTTGTTTGAGACGAAGTTCTTTGGGAAATAATCTCTCCATCCTCTGG
GAGAGGTAGGGGTAAGGTCTCTGTCTTTCCCATACCACACTTATAGGAATATGTTGGATATGTTTGTAAGCTTATGTAGTGCAGATTTTG
AACCAATTTTATAGTATACTGAATAAAACAACAGGGTAATTGGACAAAAAGAACCTAAATCACAAATTTCACATACAGAGAAGAGTTGAA
CCATG
(5')ATGGGAAGATGCTTATCAGTTCAATCATCAAACCCAACCGAACTTAAATTTCAAACTTTGAATGGAATTCATCAACTAGCT
GaAAGTTGTTGATXTCAAGGCATGGTTTCTGGATCAGTTTGGTGTGCTTCATGATGGGAAACATCCCTATCCTGGTGCCATTTCGGCCTT
GGAAAAGTTGGCAACTTATGGTGCAAAGATGGTAATCATTAGTAATTCTTCGAGAAGAGCATCCACAACCCTGGAAAAATTGAGGAGCCT
TGGATTTGACCCGTCGCTCTTTATTGGTGCAATCACGAGTGGTGAATTAACACATCAGTATCTTCAAACGAGAGATGACGCTTGGTTTGC
CTCAATAGGAAGATCGTGTATTCACATGACTTGGAGTGACAGGGGTGCTATATCTCTTGAAGGCCTCGGACTAGAAGTTGTAGAGAAGGT
TGAGGAAGCTGATTTTATTTTGGCTCACGGAACTGAAGCCTTGGGGCTTTCTTCTGGTGCCGCAGTTCCTATGAATCTTGATGAACTTGA
AAAGATACTGGATCAGTGTGCTGCTAAGAAAATCCCCATGGTAGTAGCAAATCCTGATTTTGTAACCGTTGAAGCTAGATCTCTGCGTGT
TATGCCTGGAACATTGGCAGCCACGTATGAGAAACTTGGCGGTGAAGTGAAATGGATGGGTAAACCTGATAAGATAATATACAAGTCAGC
TATGGAAATGGCTTCTGTTGTGGATGCCTCCGATTGTGTAGCTATAGGGGACTCCCTTCACCATGATATCAAAGGCGCAAATGTAGCTGG
AATTGCTTCAGCGTTTATCACAGGCGGAATACATGCTGCTGAACTTGGACTTGGAAAATTCGGAGAAGTCGTGGATGATGATAATGTACA
TGCTCTTGCCTTGGCAAGCAATGCATATCCTACATATGTGCTGCCTTCATTTACTTGG(3')TGAAGAATGTACTGTTCACTTTTGTACA
TCTTTTTGATTCTTTTGCTTTTGGTGTCAATCATTGTGTTTTAACTGAATTTGTTTTTTCCTTGAACCATCCATTTTATCTTGGTGGAAT
ACAAGGATTTTCATGATCAAGTCTTAAATTACTTATTGTAATTATAGGTAAGGTGAACTATAAGAGAAATGGTAGTATTTTTTTTACTGA
AAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan