ESTScan Details for Unigene SGN-U326864

Score 
427
Direction 
Forward
Predicted Peptide Sequence 
IDGTKSFITGKPVFGTLIALLYKGKPILGVIDQPVLRXEVDWFKRATNYLEWARNIHTNCSSLSKAYMYTTSPHLFEGDAEIAFARVRSK
VKVPLYGCDCYAYALLASGFVDLVVESGLKPYDFLSLVPVIEGAGGTITDWKGQHFNWKASAGSPATSFNVVAAGDKEVHQEALDAXAVA
VEAAMFHCIGSQLPLANIIVIDYFAAESLH
Predicted Coding Sequence 
ATAGATGGTACTAAGAGTTTCATCACAGGGAAACCTGTGTTTGGCACTCTTATTGCTCTGTTGTACAAAGGTAAACCGATTCTTGGCGTT
ATTGACCAGCCTGTACTGAGAGAXGAGGTGGATTGGTTTAAGCGGGCGACGAACTACCTTGAATGGGCAAGAAATATCCACACCAACTGT
TCAAGTCTTTCAAAAGCCTACATGTACACTACTAGCCCACATTTGTTCGAAGGGGATGCTGAGATTGCCTTTGCTCGTGTTAGAAGCAAG
GTGAAAGTTCCACTGTACGGATGTGACTGCTATGCTTATGCCCTATTGGCTTCTGGATTTGTGGATCTTGTAGTAGAGTCTGGTCTTAAG
CCGTACGACTTCCTCTCACTTGTACCAGTAATAGAAGGTGCTGGAGGAACAATAACCGACTGGAAAGGCCAACATTTTAATTGGAAAGCT
TCTGCTGGTTCACCAGCCACAAGTTTTAATGTAGTGGCAGCCGGTGATAAAGAAGTTCACCAAGAAGCTCTGGATGCAXTTGCAGTGGCG
GTAGAGGCTGCTATGTTTCACTGTATTGGCTCACAACTCCCTTTGGCGAATATCATAGTTATTGATTACTTTGCCGCTGAGTCTCTACAT
TAA
Edits in Original Sequence 
(5')ATAGATGGTACTAAGAGTTTCATCACAGGGAAACCTGTGTTTGGCACTCTTATTGCTCTGTTGTACAAAGGTAAACCGATTCTTGG
CGTTATTGACCAGCCTGTACTGAGAGAXGAGGTGGATTGGTTTAAGCGGGCGACGAACTACCTTGAATGGGCAAGAAATATCCACACgCA
ACTGTTCAAGTCTTTCAAAAGCCTACATGTACACTACTAGCCCACATTTGTTCGAAGGGGATGCTGAGATTGCCTTTGCTCGTGTTAGAA
GCAAGGTGAAAGTTCCACTGTACGGATGTGACTGCTATGCTTATGCCCTATTGGCTTCTGGATTTGTGGATCTTGTAGTAGAGTCTGGTC
TTAAGCCGTACGACTTCCTCTCACTTGTACCAGTAATAGAAGGTGCTGGAGGAACAATAACCGACTGGAAAGGCCAACATTTTAATTGGA
AAGCTTCTGCTGGTTCACCAGCCACAAGTTTTAATGTAGTGGCAGCCGGTGATAAAGAAGTTCACCAAGAAGCTCTGGATGCAXTTGCAG
TGGCGGTAGAGGCTGCTATGTTTCACTGTATTGGCTCACAACTCCCTTTGGCGAATATCATAGTTATTGATTACTTTGCCGCTGAGTCTC
TACATTAA(3')TTTTAACTTTTGAATCAAATTATGGTGGTCCTCTGTTGATAGTTATTTAATCAGAATGCTTACTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan