ESTScan Details for Unigene SGN-U326866

Score 
608
Direction 
Forward
Predicted Peptide Sequence 
NFKRVEQFMNEVEILTQLRHKNLVTLMGVHLNEAEIYSXVYEYIPNGTVADHLHGKRAKSGLLSWPVRMNIAIETAEALAYLHSSIIIHR
DVKTNNILLDNDFHVKVADFGLSRLFPNNVTHVSTAPQGTPGYVDPEYYQCYQLTEKSDVYSFGVVLVELISSLEAVDTSRHRHDINLSN
MAVNKIQGHSIHELVDPTLGFSTNSSVRRMTTLVAELAFRCLQQERDLRPSMQEVLETLRGIQNGESKAHNAEVLDIVVDDVGLLKDSLS
SPDSVAATNELTAPHHILVDEICFSGWLNSMQGEEATTTXGTCDQYLASSIDN
Predicted Coding Sequence 
XACAATTTCAAGCGTGTGGAGCAGTTCATGAATGAAGTAGAGATTTTAACTCAGCTACGCCACAAGAACCTAGTGACGTTGATGGGTGTA
CATCTAAACGAAGCCGAGATTTACTCCXTAGTTTATGAGTATATACCAAATGGGACAGTGGCAGATCATCTACATGGTAAACGGGCCAAA
TCTGGCTTACTCTCTTGGCCTGTCCGAATGAACATAGCCATTGAGACTGCTGAAGCCCTGGCTTATCTCCACTCCTCAATTATAATACAC
CGTGACGTCAAAACCAACAACATTCTGTTAGACAACGATTTCCATGTGAAAGTTGCTGATTTTGGGCTATCAAGACTGTTCCCAAATAAT
GTCACACATGTCTCTACTGCTCCACAGGGTACACCAGGCTACGTTGATCCTGAATACTACCAATGTTACCAGCTCACTGAAAAGAGTGAT
GTCTATAGTTTTGGGGTGGTCTTGGTAGAGCTGATCTCATCATTAGAAGCTGTGGATACCAGCAGGCACCGCCATGATATTAATTTGTCT
AATATGGCTGTCAACAAGATCCAAGGTCATTCAATTCATGAATTAGTTGATCCAACTCTTGGATTCTCAACAAACAGCTCCGTGAGGAGG
ATGACTACATTAGTCGCAGAGTTAGCTTTCCGATGTCTGCAACAAGAGAGAGATCTGAGACCTTCAATGCAAGAAGTGCTGGAGACATTG
AGAGGCATCCAGAATGGAGAGTCGAAAGCACACAATGCTGAGGTACTGGATATTGTGGTAGATGATGTTGGGCTCCTAAAGGACTCCCTT
TCTTCTCCGGATTCAGTTGCCGCTACAAATGAGTTGACAGCTCCACACCACATTCTAGTGGATGAAATATGTTTTTCAGGTTGGTTGAAT
TCGATGCAAGGTGAGGAAGCAACTACTACTXATGGCACTTGTGATCAGTATCTCGCGTCTTCCATAGATAATTAA
Edits in Original Sequence 
(5')XACAATTTCAAGCGTGTGGAGCAGTTCATGAATGAAGTAGAGATTTTAACTCAGCTACGCCACAAGAACCTAGTGACGTTGtATGG
GTGTACATCTAAACGAAGCCGAGATTTACTCCXTAGTTTATGAGTATATACCAAATGGGACAGTGGCAGATCATCTACATGGTAAACGGG
CCAAATCTGGCTTACTCTCTTGGCCTGTCCGAATGAACATAGCCATTGAGACTGCTGAAGCCCTGGCTTATCTCCACTCCTCAATTATAA
TACACCGTGACGTCAAAACCAACAACATTCTGTTAGACAACGATTTCCATGTGAAAGTTGCTGATTTTGGGCTATCAAGACTGTTCCCAA
ATAATGTCACACATGTCTCTACTGCTCCACAGGGTACACCAGGCTACGTTGATCCTGAATACTACCAATGTTACCAGCTCACTGAAAAGA
GTGATGTCTATAGTTTTGGGGTGGTCTTGGTAGAGCTGATCTCATCATTAGAAGCTGTGGATACCAGCAGGCACCGCCATGATATTAATT
TGTCTAATATGGCTGTCAACAAGATCCAAGGTCATTCAATTCATGAATTAGTTGATCCAACTCTTGGATTCTCAACAAACAGCTCCGTGA
GGAGGATGACTACATTAGTCGCAGAGTTAGCTTTCCGATGTCTGCAACAAGAGAGAGATCTGAGACCTTCAATGCAAGAAGTGCTGGAGA
CATTGAGAGGCATCCAGAATGGAGAGTCGAAAGCACACAATGCTGAGGTACTGGATATTGTGGTAGATGATGTTGGGCTCCTAAAGGACT
CCCTTTCTTCTCCGGATTCAGTTGCCGCTaACAAATGAGTTGACAGCTCCACACCACATTCTAGTGGATGAAATATGTTTTTCAGGTTGG
TTGAATTCGATGCAAGGTGAGGAAGCAACTACTACTXATGGCACTTGTGATCAGTATCTCGCGTCTTCCATAGATAATTAA(3')TTTCT
TATTTTTGCTTACATATAGTTATGTTGTTATCGTCAATATTTTCTGTGGGAGATTATTTAAAACTGCTTTTCGCATAAGGCAATGTATAT
AAATAGTGACCGACATTCTAGTATACATATGCATCTCTGCTCTTTTGAAAAAAAAAAAAAAAAAAAAACTCGAGGGGGGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan