ESTScan Details for Unigene SGN-U326915

Score 
199
Direction 
Forward
Predicted Peptide Sequence 
ETLGGGNYVSAFRMLMVMFRREFSFSDSLYLWEMMWSLEYDPELFSMYEEDPDLTAENSRRAKVKSIRQYGKYERENMRSGGKDTEAPLP
ISVXPSSQRPEGQECEAKEARGLDEVVKILNNITGHLDARKACSSAMKLHKKYLKKAANTNRXVEQRRVLCNILTELNDNIFSLLAKKV
Predicted Coding Sequence 
GAGACATTAGGTGGAGGAAATTACGTGTCXGCTTTTCGGATGCTCATGGTTATGTTCCGTCGAGAATTTTCTTTCTCTGATTCGTTATAT
CTTTGGGAGATGATGTGGTCTCTGGAATATGATCCTGAGTTATTTTCCATGTATGAAGAAGACCCTGACTTGACTGCTGAAAATTCTAGA
CGAGCAAAAGTTAAGTCGATACGTCAGTATGGGAAATATGAGAGAGAAAACATGAGAAGTGGAGGTAAAGATACAGAAGCTCCCCTCCCA
ATTTCTGTTXTTCCTAGTAGCCAGCGTCCTGAAGGACAAGAGTGCGAAGCTAAAGAAGCTAGAGGACTGGACGAAGTTGTTAAGATCCTG
AATAATATTACTGGACACTTGGATGCCAGAAAGGCTTGCAGTAGCGCTATGAAGCTTCACAAGAAGTATCTTAAGAAGGCAGCCAACACT
AATAGGXTAGTCGAGCAGAGGCGAGTACTATGTAATATTCTCACTGAACTTAACGACAACATCTTCTCGTTGCTGGCCAAGAAGGTATGA
Edits in Original Sequence 
(5')GAGACATTAGGTGGAGGAAATTACGTGTCXGCTTTTCGGATGCTCATGGTTATGTTCCGTCGAGAATTTTCTTTCTCTGATTCGTT
ATATCTTTGGGAGATGATGTGGTCTCTGGAATATGATCCTGAGTTATTTTCCATGTATGAAGAAGACCCTGACTTGACTGCTGAAAATTC
TAGACGAGCAAAAGTTAAGTCGATACGTCAGTATGGGAAATATGAGAGAGAAAACATGAGAAGTGGAGGTAAAGATACAGAAGCTCCCCT
CCCAATTTCTGTTXTTCCTAGTAGCCAGCGTCCTGAAGGACAAGAGTGCGAAGCTAAcAGAAGCTAGAGGACTGGACGAAGTTGTTAAGA
TCCTGAATAATATTACTGGACACTTGGATGCCAGAAAGGCTTGCAGTAGCGCTATGAAGCTTCACAAGAAGTATCTTAAGAAGGCAGCCA
ACACTAATAGGXTAGTCGAGCAGAGGCGAGTACTATGTAATATTCTCACTGAACTTAACGACAACATCTTCTCGTTGCTGGCCAAGAAGG
TATGA(3')CAAGAATCTATATTTATATATTTTGGGCTGGTCGATGAACATTAGCTGCTTTTGCTATTGTAGTTATGTTATGATGTGCTA
AGACGTAATTGTTGTATTCAATCCAAATGTAATGTACAAGGACACACTTCCAAAGTTTGTACTATAATCTCAGGAACAAAACAATGTTCC
ATATTTGTAAGGGATAGCTTCAAATATATTATAATAAATATACTCATGTTTTTATAGAAAAAAAAAAAAAAAAAAAAAAAACTCGAGGGG
GGCCCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan