ESTScan Details for Unigene SGN-U326961

Score 
528
Direction 
Forward
Predicted Peptide Sequence 
MATARIVPLKALVNGVSPWNPALTSPPAPFSSSILSRRDYSAAISPPSKAVVYDQHGSPDVVTRVTELPPVEIKDNDGALXMLAAPINPS
DINRIEGVYPVRPPLPAVGGYEGVGEVHAIGSAVKGLSPGDWVIPSPPSSGTWQTYVVKEQSVWQKVDKSTPMEYAATVIVNPLTALRML
EDFIALKSGDTIVQNGATSIVGQCVIQLARLRGIHSINIIRDRAGSDEAKAHLKQLGADEVYTESQLEVKNVRGLLGNIPEPVLGFNCVG
GNAASXDPKIPX
Predicted Coding Sequence 
ATGGCGACTGCTAGGATTGTACCCCTAAAAGCCCTCGTAAATGGAGTTTCACCATGGAATCCXGCTCTCACGAGTCCTCCGGCTCCGTTC
TCGTCCTCTATACTCAGCCGTCGAGATTATTCCGCCGCCATTTCGCCGCCTTCTAAGGCCGTTGTCTACGATCAACACGGCTCTCCTGAT
GTTGTCACTAGAGTGACGGAGCTTCCGCCGGTGGAAATTAAAGACAATGATGGTGCGTTAGAXATGCTTGCGGCTCCGATCAATCCTTCT
GATATTAATAGAATTGAAGGAGTTTATCCTGTCCGACCACCGTTGCCTGCAGTTGGGGGATATGAAGGTGTTGGAGAAGTACATGCCATT
GGTTCTGCAGTTAAGGGTCTTTCCCCGGGAGATTGGGTTATCCCTTCCCCACCTTCTTCAGGGACATGGCAGACATACGTCGTAAAAGAA
CAGAGTGTGTGGCAGAAAGTTGATAAAAGCACCCCAATGGAGTATGCTGCGACTGTTATTGTCAATCCGTTGACTGCCTTGAGAATGCTT
GAGGACTTTATTGCATTAAAATCAGGGGACACTATTGTGCAAAATGGTGCTACAAGCATAGTGGGTCAATGTGTTATTCAACTAGCTCGA
CTCCGTGGGATTCATAGCATCAATATCATTAGAGACAGGGCAGGATCAGATGAAGCAAAAGCCCATCTCAAGCAACTAGGTGCTGATGAA
GTGTATACTGAAAGCCAACTGGAAGTGAAGAATGTCAGAGGTCTTCTGGGCAATATACCTGAACCTGTTTTAGGCTTTAATTGTGTTGGT
GGCAATGCTGCTTCAXTTGATCCTAAAATTCCTGXX
Edits in Original Sequence 
AATCGGCCGAATTGATAGTTCATTTTGGAAGGTTCTGTA(5')ATGGCGACTGCTAGGATTGTACCCCTAAAAGCCCTCGTAAATGGAGT
TTCACCATGGAATCCXGCTCTCACGAGTCCTCCGGCTCCGTTCTCGTCCTCTATACTCAGCCGTaCGAGATTATTCCGCCGCCATTTCGC
CGCCTTCTAAGGCCGTTGTCTACGATCAACACGGCTCTCCTGATGTTGTCACTAGAGTGACGGAGCTTCCGCCGGTGGAAATTAAAGACA
ATGATGtGTGCGTTAGAXATGCTTGCGGCTCCGATCAATCCTTCTGATATTAATAGAATTGAAGGAGTTTATCCTGTCCGACCACCGTTG
CCTGCAGTTGGGGGATATGAAGGTGTTGGAGAAGTACATGCCATTGGTTCTGCAGTTAAGGGTCTTTCCCCGGGAGATTGGGTTATCCCT
TCCCCACCTTCTTCAGGGACATGGCAGACATACGTCGTAAAAGAACAGAGTGTGTGGCAGAAAGTTGATAAAAGCACCCCAATGGAGTAT
GCTGCGACTGTTATTGTCAATCCGTTGACTGCCTTGAGAATGCTTGAGGACTTTATTGCATTAAAATCAGGGGACACTATTGTGCAAAAT
GGTGCTACAAGCATAGTGGGTCAATGTGTTATTCAACTAGCTCGACTCCGTGGGATTCATAGCATCAATATCATTAGAGACAGGGCAGGA
TCAGATGAAGCAAAAGCCCATCTCAAGCAACTAGGTGCTGATGAAGTGTATACTGAAAGCCAACTGGAAGTGAAGAATGTCAGAGGTCTT
CTGGGCAATATACCTGAACCTGTTTTAGGCTTTAATTGTGTTGGTGGCAATGCTGCTTCAXTTGATCCTAAAATTCCTGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan