ESTScan Details for Unigene SGN-U327034

Score 
357
Direction 
Forward
Predicted Peptide Sequence 
LMLALRKLSTLKSSRFLSSLAIQNPICSSLTILDVPSCTNYDERINKAGREGDFTTVHQLLNKRGAMASSTRTIXFKFIYTTNVSILDDL
LEIIARLDNGFPRKSSYDCLIARLSKMHCISEAMRVAKAMVSKGHEVNNVTFHPIVNALTKKEEFEEAWRVVAVMKSCGISPDLTTYNFL
LTGYCFAGNVASAAGVLAKIEEEELGADTRTYDALVLGACRAGKLDAALAVVRRMLDDGVPPLYSTHAHIIRALLKYNYYEQAVEFVRSY
AGRDAKLDAENFGILATRLITRSKLEEAKKLVKEMSERRLVMGPRLKDFYELYVRSDGLR
Predicted Coding Sequence 
XCATTAATGCTAGCACTTCGCAAGCTCTCGACCCTAAAATCATCAAGATTTCTCTCTTCTCTCGCTATTCAAAACCCTATCTGCAGTTCC
TTAACCATCCTAGACGTTCCCAGTTGCACCAACTACGATGAACGCATCAACAAAGCTGGCCGTGAAGGAGATTTCACCACTGTCCACCAA
CTTCTTAACAAGCGCGGCGCGATGGCTTCTTCAACACGAACAATACXGTTCAAGTTCATTTACACCACTAATGTGTCCATACTCGATGAT
CTATTGGAAATTATAGCTCGGTTAGATAATGGTTTCCCGAGAAAGAGCTCCTACGACTGTCTCATTGCCCGTCTCTCGAAGATGCACTGC
ATTTCGGAGGCTATGCGTGTTGCCAAAGCTATGGTGAGCAAAGGTCACGAAGTGAACAATGTCACGTTTCATCCCATAGTTAATGCTCTG
ACGAAGAAGGAGGAATTCGAAGAAGCCTGGCGAGTGGTGGCGGTGATGAAATCCTGCGGGATTTCTCCTGATTTGACGACGTATAATTTT
CTGTTGACAGGTTATTGTTTTGCCGGAAATGTGGCATCAGCTGCTGGTGTTCTAGCAAAGATAGAGGAGGAGGAGCTGGGGGCGGATACG
AGGACTTACGACGCCCTGGTTTTAGGCGCCTGTAGAGCAGGGAAACTGGATGCTGCTTTGGCAGTGGTGAGGAGGATGCTAGATGACGGA
GTTCCGCCATTGTATAGCACACACGCCCATATTATCCGAGCATTATTGAAGTATAATTATTATGAACAGGCGGTAGAGTTTGTTAGGAGC
TATGCAGGAAGAGACGCCAAATTGGATGCAGAAAATTTTGGAATACTGGCCACCAGATTGATCACTCGGAGTAAATTGGAGGAAGCTAAG
AAACTGGTTAAAGAGATGAGTGAAAGGAGATTGGTAATGGGTCCGAGATTGAAAGATTTCTATGAATTGTACGTTAGATCTGATGGTTTG
AGATAA
Edits in Original Sequence 
(5')XCATTAATGCTAGCACTTCGCAAGCTCTCGACCCTAAAATCATCAAGATTTCTCTCTTCTCTCGCTATTCAAAACCCTATCTGCAG
TTCCTTAACCATCCTAGACGTTCCCAGTTGCACCAACTACGATGAACGCATCAACAAAGCTGGCCGTGAAGGAGATTTCACCACTGTCCA
CCAACTTCTTAACAAGCGCGcGCGCGATGGCTTCTTCAACACGAACAATACXGTTCAAGTTCATTTACACCACTAATGTGTCCATACTCG
ATGATCTATTGGAAATTATAGCTCGGTTAGATAATGGTTTCCCGAGAAAGAGCTCCTACGACTGTCTCATTGCCCGTCTCTCGAAGATGC
ACTGCATTTCGGAGGCTATGCGTGTTGCCAAAGCTATGGTGAGCAAAGGTCACGAAGTGAACAATGTCACGTTTCATCCCATAGTTAATG
CTCTGACGAAGAAGGAGGAATTCGAAGAAGCCTGGCGAGTGGTGGCGGTGATGAAATCCTGCGGGATTTCTCCTGATTTGACGACGTATA
ATTTTCTGTTGACAGGTTATTGTTTTGCCGGAAATGTGGCATCAGCTGCTGGTGTTCTAGCAAAGATAGAGGAGGAGGAGCTGGGGGCGG
ATACGAGGACTTACGACGCCCTGGTTTTAGGCGCCTGTAGAGCAGGGAAACTGGATGCTGCTTTGGCAGTGGTGAGGAGGATGCTAGATG
ACGGAGTTCCGCCATTGTATAGCACACACGCCCATATTATCCGAGCATTATTGAAGTATAATTATTATGAACAGGCGGTAGAGTTTGTTA
GGAGCTATGCAGGAAGAGACGCCAAATTGGATGCAGAAAATTTTGGAATACTGGCCACCAGATTGATCACTCGGAGTAAATTGGAGGAAG
CTAAGAAACTGGTTAAAGAGATGAGTGAAAGGAGATTGGTAATGGGTCCGAGATTGAAAGATTTCTATGAATTGTACGTTAGATCTGATG
GTTTGAGATAA(3')TTATTGAGTATGAATGCTGCATTTTTGAAATGTAAAGACTTGGTTTTGTTGGATTTTAGTATTTAAAAGAAAATT
TCATGGATCAAAAAAAAAAAAAAAAACTCAGACTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan