Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U327041

Score 
649
Direction 
Forward
Predicted Peptide Sequence 
NPNFVLTEGRSGYNXDEETAEKMGKLPPSLRSANFAVNTLIKTPSPSPSPSPPPTSKPHYYPKKSQSPKKKPTSITEPQLPSSILAFDST
SLSDAKTLFNSXDFQYQKPLTDNKFYNAVLQSFSSNSTLQDSIFFLNHMIKVHPPFSPDRFTYHVLLVQSCKSVDLSLSPVHQVLNLMTT
NGFPPNKVSTDIAVRTLCSSGHEEQAIELVKELSSKDSPPDTYTYNFIIRHLCKNRPLSTMNNFIKEMREGFDIKPDLVTYTIMIDNVCN
SKNLX
Predicted Coding Sequence 
AACCCTAATTTTGTCCTCACAGAAGGAAGAAGTGGTTACAACAAXGACGAAGAAACAGCTGAGAAAATGGGGAAATTACCACCTTCCTTA
AGGTCAGCTAACTTTGCTGTAAACACTCTCATCAAAACTCCATCTCCATCCCCATCCCCATCCCCACCTCCAACCTCAAAACCCCATTAT
TATCCCAAAAAATCACAATCACCCAAGAAAAAACCCACATCAATTACTGAACCCCAGCTTCCATCATCTATTCTAGCCTTTGATTCAACA
TCTCTTTCAGATGCTAAAACCCTTTTCAATTCTXCTGATTTCCAGTACCAGAAACCCCTCACAGACAACAAATTTTATAATGCAGTTCTT
CAATCATTTTCCTCCAATTCAACTCTCCAAGATTCAATCTTTTTCCTTAATCACATGATCAAGGTTCACCCTCCTTTCTCCCCTGACAGG
TTTACATACCATGTTCTCCTCGTCCAATCTTGTAAGTCTGTTGACCTTTCTTTATCCCCTGTTCATCAGGTTCTTAATCTTATGACTACC
AATGGTTTCCCTCCTAATAAGGTCTCCACAGACATTGCTGTGAGGACCCTTTGCTCTTCCGGCCACGAAGAGCAAGCCATTGAGCTAGTG
AAAGAACTTTCCTCCAAAGACTCTCCCCCTGATACATATACTTATAATTTTATTATTAGGCATTTGTGCAAGAACAGGCCTTTGAGTACC
ATGAATAACTTTATTAAAGAAATGAGGGAAGGTTTTGATATAAAACCTGATCTTGTTACATATACAATTATGATTGACAATGTTTGTAAT
AGTAAAAATCTTAXX
Edits in Original Sequence 
(5')AACCCTAATTTTGTCCTCACAGAAGGAAGAAGTGGTTACAACAAXGACGAAGAAACAGCTGAGAAAATGGGGAAATTACCACCTTC
CTTAAGGTCAGCTAACTTTGCTGTAAACACTCTCATCAAAACTCCATCTCCATCCCCATCCCCATCCCCACCTCCAACCTCAAAACCCCA
TTATTATCCCAAAAAATCACAATCACCCAAGAAAAAACCCACATCAATTACTGAACCCCAGCTTCCATCATCTATTCTAGCCTTTGATTC
AACATCTCTTTCAGATGCTAAAACCCTTTTCAATTCTXCTGATTTCCAGTACCAGAAACCCCTCtACAGACAACAAATTTTATAATGCAG
TTCTTCAATCATTTTCCTCCAATTCAACTCTCCAAGATTCAATCTTTTTCCTTAATCACATGATCAAGGTTCACCCTCCTTTCTCCCCTG
ACAGGTTTACATACCATGTTCTCCTCGTCCAATCTTGTAAGTCTGTTGACCTTTCTTTATCCCCTGTTCATCAGGTTCTTAATCTTATGA
CTACCAATGGTTTCCCTCCTAATAAGGTCTCCACAGACATTGCTGTGAGGACCCTTTGCTCTTCCGGCCACGAAGAGCAAGCCATTGAGC
TAGTGAAAGAACTTTCCTCCAAAGACTCTCCCCCTGATACATATACTTATAATTTTATTATTAGGCATTTGTGCAAGAACAGGCCTTTGA
GTACCATGAATAACTTTATTAAAGAAATGAGGGAAGGTTTTGATATAAAACCTGATCTTGTTACATATACAATTATGATTGACAATGTTT
GTAATAGTAAAAATCTTAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan