ESTScan Details for Unigene SGN-U327047

Score 
461
Direction 
Forward
Predicted Peptide Sequence 
LNQPQPVTSERSFNRENPPFGIGLSSTRGREPEVTVEQRGNQQPIERNENVVMGSNENRPASTSNNASNVKEKESIRADASAKKIPSFWT
ACPYCYVMHEYPLDYVDCTLKCQNCKRAFQAVKVAAPPIIDGKEAYFCCWGFMPLGFSVEHFERSRNNVSSWSPFSPMFACPTSGANGGR
NAKNNAVGGQSNVSTFGNLHNAGGSRSRSGRKISAPRIYSDDDDDDDDDDDVLVDISEVLSGDA
Predicted Coding Sequence 
XATTTAAACCAACCACAGCCTGTAACTTCTGAGAGGAGCTTTAATAGAGAAAATCCACCATTTGGTATTGGTTTGAGCTCGACGAGAGGG
CGAGAACCGGAGGTAACTGTTGAGCAGCGTGGGAATCAACAGCCCATAGAAAGAAATGAGAATGTAGTGATGGGTAGCAATGAAAATAGA
CCTGCTAGTACTAGTAATAATGCGAGTAATGTGAAGGAGAAAGAGAGTATTAGGGCAGATGCATCAGCTAAGAAGATACCTAGTTTCTGG
ACAGCATGTCCTTATTGTTACGTTATGCACGAGTACCCTTTGGATTATGTTGATTGTACACTAAAGTGTCAAAATTGTAAGAGGGCTTTT
CAAGCTGTTAAGGTTGCTGCTCCGCCTATTATTGATGGAAAAGAAGCTTATTTCTGTTGTTGGGGATTTATGCCTTTAGGATTTTCCGTG
GAGCATTTCGAGAGAAGTAGGAATAATGTTTCAAGCTGGTCTCCGTTTTCGCCCATGTTTGCTTGTCCAACCTCGGGGGCGAATGGCGGG
AGGAATGCTAAGAATAATGCTGTTGGGGGGCAGAGTAATGTGAGTACTTTTGGTAATTTGCATAATGCTGGCGGGTCGAGAAGTCGGAGT
GGACGAAAGATTTCTGCTCCAAGGATTTACAGTGATGACGATGACGACGATGATGACGATGATGATGTACTTGTTGACATATCGGAGGTA
CTTTCTGGAGATGCTTAA
Edits in Original Sequence 
(5')XATTTAAACCAACCACAGCCTGTAACTTCTGAGAGGAGCTTTAATAGAGAAAATCCACCATTTGGTATTGGTTTGAGCTCGACGAG
AGGGCGAGAACCGGAGGTAACTGTTGAGCAGCGTGGGAATCAACAGCCCATAGAAAGAAATGAGAATGTAGTGATGGGTAGCAATGAAAA
TAGACCTGCTAGTACTAGTAATAATGCGAGTAATGTGAAGGAGAAAGAGAGTATTAGGGCAGATGCATCAGCTAAGAAGATACCTAGTTT
CTGGACAGCATGTCCTTATTGTTACGTTATGCACGAGTACCCTTTGGATTATGTTGATTGTACACTAAAGTGTCAAAATTGTAAGAGGGC
TTTTCAAGCTGTTAAGGTTGCTGCTCCGCCTATTATTGATGGAAAAGAAGCTTATTTCTGTTGTTGGGGATTTATGCCTTTAGGATTTTC
CGTGGAGCATTTCGAGAGAAGTAGGAATAATGTTTCAAGCTGGTCTCCGTTTTCGCCCATGTTTGCTTGTCCAACCTCGGGGGCGAATGG
CGGGAGGAATGCTAAGAATAATGCTGTTGGGGGGCAGAGTAATGTGAGTACTTTTGGTAATTTGCATAATGCTGGCGGGTCGAGAAGTCG
GAGTGGACGAAAGATTTCTGCTCCAAGGATTTACAGTGATGACGATGACGACGATGATGACGATGATGATGTACTTGTTGACATATCGGA
GGTACTTTCTGGAGATGCTTAA(3')CATATCGGAGGTCCTTACTACTCCAATGTAGAGAAAGGTAAATTCTTGAAAAATTTTATAATAG
GTGAAAAAGGAAGAGATTCTAGCCTTTCATTTCTTTCCAAACTTGAATCTTTCCCTAATTTCCTTTGAATATCGTGTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan