ESTScan Details for Unigene SGN-U327252

Score 
353
Direction 
Forward
Predicted Peptide Sequence 
EDQQSSPVASLPVLPKILDPALSFVDPLKFLILLKAYESFSPKQKIELTSSQFNLLMNLNHLLKPPIILAGXDAIQEEINAQEKNNKXLV
SLPAGKEAIGCKWIYKIKHKADGSVDRYKARLVAKGFFKNIESNPFPYSQVAQGPPLEKGKHLLQVAKHHSWHSCLGCNQKVALFQFDVQ
NRMPFNNIREGGKNXVSIQPPPTPGFSSPRNPNLVCKLKKAIYVTASGKLKQAQELGLKGDSSMYKSRNRSRGRSRFSNK
Predicted Coding Sequence 
XXAGAAGATCAGCAGTCTAGCCCAGTTGCTTCCCTTCCAGTGCTTCCTAAAATTCTGGATCCCGCTCTCAGCTTCGTCGATCCTCTCAAG
TTTCTTATCCTGTTGAAGGCTTATGAATCGTTTTCCCCAAAACAAAAGATCGAGCTTACCTCATCTCAGTTCAATCTTCTCATGAACCTG
AATCATTTGCTGAAGCCTCCAATCATTCTTGCTGGAGAXGATGCTATACAGGAAGAAATCAATGCCCAGGAAAAAAATAATAAGAXCTTA
GTCTCATTGCCTGCAGGGAAAGAAGCCATTGGCTGCAAGTGGATTTACAAGATCAAGCATAAAGCAGATGGCTCGGTAGATAGATACAAG
GCTAGATTAGTAGCTAAAGGATTCTTCAAGAATATTGAGTCGAACCCCTTTCCTTACAGTCAAGTGGCCCAAGGGCCCCCTTTAGAGAAG
GGAAAACATTTGCTTCAGGTTGCTAAACACCATTCGTGGCATTCTTGCCTTGGCTGCAATCAAAAGGTGGCCTTATTTCAATTTGACGTG
CAGAATAGAATGCCTTTCAACAACATAAGGGAAGGGGGCAAGAATAXAGTTTCTATTCAGCCTCCTCCAACTCCAGGCTTCTCTTCTCCT
AGGAATCCTAACTTGGTATGCAAGCTCAAGAAAGCGATTTATGTTACGGCCTCCGGCAAGCTAAAGCAGGCACAAGAGCTTGGTTTGAAA
GGTGACAGCAGCATGTATAAGAGCCGAAATAGGAGTAGAGGAAGGAGCCGGTTTTCAAATAAGTAA
Edits in Original Sequence 
(5')XXAGAAGATCAGCAGTCTAGCCCAGTTGCTTCCCTTCCAGTcGCTTCCTAAAATTCTGGATCCCGCTCTCAGCTTCGTCGATCCTC
TCAAGTTTCTTATCCTGTTGAAGGCTTATGAATCGTTTTCCCCAAAACAAAAGATCGAGCTTACCTCATCTCAGTTCAATCTTCTCATGA
ACCTGAATCATTTGCTGAAGCCTCCAATCATTCTTGCTGGAGAXGATGCTATACAGGAAGAAATCAATGCCCAGGAAAAAAATAATAAGA
XCTTAGTCTCATTGCCTGCAGGGAAAGAAGCCATTGGCTGCAAGTGGATTTACAAGATCAAGCATAAAGCAGATGGCTCGGTAGATAGAT
ACAAGGCTAGATTAGTAGCTAAAGGATTcCTTCAAGAATATTGAGTCGAACCCCTTTCCTTACAGTCAAGTGGCCCAAGGGCCCCCTTTA
GAGAtAGGGAAAACATTTGCTTCAGGTTGCTAAACACCATTCGTGGCATTCTTGCCTTGGCTGCAATCAAAAGGTGGCCTTATTTCAATT
TGACGTGCAGAATAGAATGCCTTTCAACAACATAAGGGAAGGGGGCAAGAATAXAGTTTCTATTCAGCCTCCTCCAACTCCAGGCTTCTC
TTCTCCTAGGAATCCTAACTTGGTATGCAAGCTCAAGAAAGCGATTTATGTTACGGCCTCCGGCAAGCTAAAGCAGGCACAAGAGCTTGG
TTTGAAAGGTGACAGCAGCATGTATAAGAGCCGAAATAGGAGTAGAGGAAGGAGCCGGTTTTCAAATAAGTAA(3')ATCGGATCATTCA
ATGTTTATAAGGAGGTCGACATCAGGTATTGTCCTTCTTCTGCGTGGATGACATTGCTTTCTCTAGTAATGACTTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan