ESTScan Details for Unigene SGN-U327484

Score 
868
Direction 
Forward
Predicted Peptide Sequence 
VTIHWHGVRQMRTGWADGPEFITQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIINPKEGVIYPFPKPKRETPILLGEWW
NTNPIDVVRQATRTGAAPNISDAYTINSQPGDLYKCSSQDTAIVHMDSGEINLLRVINAALNQQLFFAVANHKLTVVGADATYVKPFTTS
VLMLGPGQTTDVLIKADQQPARYYMAARAYASAQDAPFDDTTTTAILEYNTASCSTNCVKTKPVFPSLPAYNDTSTATTFSTKFRSPRRV
EVPKEIDENLFFTVGLGLENCPRGAPSSYCQGPSGTRFTASMNNVSFTLPSNNSPXYKHITKAYLGVFSTDFPAX
Predicted Coding Sequence 
GTTACTATTCACTGGCATGGTGTTAGGCAAATGAGAACAGGATGGGCAGATGGACCAGAATTTATCACTCAGTGCCCGATTAGACCAGGA
AAGAGTTACACTTACCGGTTTACTATTCAAGGACAAGAAGGGACTCTTTGGTGGCACGCCCACAGCTCGTGGCTTAGGGCTACTGTTTAT
GGAGCTTTAATTATCAATCCAAAAGAAGGAGTAATCTATCCATTTCCAAAGCCCAAAAGAGAAACACCAATTCTGCTCGGTGAGTGGTGG
AATACGAACCCTATTGACGTTGTAAGACAAGCAACAAGAACAGGAGCAGCTCCTAATATATCTGATGCATACACCATCAATTCTCAACCA
GGTGACCTCTACAAGTGTTCTAGTCAAGATACCGCCATAGTTCATATGGACTCTGGTGAAATCAACCTCCTTCGAGTTATCAACGCTGCC
CTGAACCAGCAGCTTTTCTTTGCTGTGGCCAATCACAAACTTACTGTCGTTGGAGCAGATGCCACTTATGTTAAACCCTTCACAACATCA
GTCCTTATGCTCGGACCAGGCCAGACAACTGATGTCCTGATCAAAGCTGATCAACAACCCGCTCGATATTACATGGCAGCACGTGCCTAT
GCTAGTGCTCAAGACGCCCCTTTTGATGATACCACAACCACAGCCATCCTCGAGTACAACACAGCTTCTTGTTCTACGAATTGTGTCAAG
ACCAAACCGGTTTTCCCATCTTTACCAGCATATAATGACACATCCACTGCCACAACTTTCTCAACCAAATTCAGAAGCCCAAGAAGGGTC
GAGGTTCCCAAGGAAATCGATGAAAATCTGTTCTTCACAGTTGGGCTGGGACTCGAGAACTGCCCAAGAGGTGCACCCTCCAGTTACTGT
CAAGGTCCAAGTGGAACTCGATTCACTGCGAGTATGAACAATGTATCTTTTACGCTACCATCCAATAATTCCCCTGXCTACAAGCACATT
ACCAAGGCATATCTGGGTGTTTTCTCAACTGATTTCCCAGCTGXX
Edits in Original Sequence 
(5')GTTACTATTCACTGGCATGGTGTTAGGCAAATGAGAACAGGATGGGCAGATGGACCAGAATTTATCACTCAGTGCCCGATTAGACC
AGGAAAGAGTTACACTTACCGGTTTACTATTCAAGGACAAGAAGGGACTCTTTGGTGGCACGCCCACAGCTCGTGGCTTAGGGCTACTGT
TTATGGAGCTTTAATTATCAATCCAAAAGAAGGAGTAATCTATCCATTTCCAAAGCCCAAAAGAGAAACACCAATTCTGCTCGGTGAGTG
GTGGAATACGAACCCTATTGACGTTGTAAGACAAGCAACAAGAACAGGAGCAGCTCCTAATATATCTGATGCATACACCATCAATTCTCA
ACCAGGTGACCTCTACAAGTGTTCTAGTCAAGATACCGCCATAGTTCATATGGACTCTGGTGAAATCAACCTCCTTCGAGTTATCAACGC
TGCCCTGAACCAGCAGCTTTTCTTTGCTGTGGCCAATCACAAACTTACTGTCGTTGGAGCAGATGCCACTTATGTTAAACCCTTCACAAC
ATCAGTCCTTATGCTCGGACCAGGCCAGACAACTGATGTCCTGATCAAAGCTGATCAACAACCCGCTCGATATTACATGGCAGCACGTGC
CTATGCTAGTGCTCAAGACGCCCCTTTTGATGATACCACAACCACAGCCATCCTCGAGTACAACACAGCTTCTTGTTCTACGAATTGTGT
CAAGACCAAACCGGTTTTCCCATCTTTACCAGCATATAATGACACATCCACTGCCACAACTTTCTCAACCAAATTCAGAAGCCCAAGAAG
GGTCGAGGTTCCCAAGGAAATCGATGAAAATCTGTTCTTCACAGTTGGGCTGGGACTCGAGAACTGCCCAAGAGGTGCACCCTCCAGTTA
CTGTCAAGGTCCAAGTGGAACTCGATTCACTGCGAGTATGAACAATGTATCTTTTACGCTACCATCCAATAATTCCCCTGXCTACAAGCA
CATTACCAAGGCATATCTGGGTGTTTTCTCAACTGATTTCCCAGCTGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan