ESTScan Details for Unigene SGN-U327520

Score 
751
Direction 
Forward
Predicted Peptide Sequence 
MVNEFMVCVDRIIIATTCFGDSSVTNGVGGRETLLTNDAVNVNSTVEIINSRKTHQEKISISTSTCVGGEGSSKGSSSSSVRECRICQEE
DEETDMEAPCACNGTLKFAHGNVFRNGATKKVTSPVKSXNKVFSPNYTLPPARSNPDVMAIDIRQAWGPGMDIRNPHFLAFAAAERQFLQ
SEYDDYAIASSGESSMFPLCCNHFDATLADTSNLDGHEGLCNGA
Predicted Coding Sequence 
ATGGTGAATGAGTTTATGGTATGTGTTGATAGGATCATAATAGCAACAACATGTTTTGGAGATTCATCAGTTACTAATGGTGTTGGTGGG
AGAGAAACCCTTTTGACTAATGATGCTGTAAATGTTAATTCTACTGTTGAAATCATCAATTCAAGAAAAACCCATCAAGAAAAAATTAGT
ATTAGTACTAGTACTTGTGTTGGTGGAGAAGGTTCTTCAAAGGGTAGTAGTAGTAGTAGTGTTAGAGAGTGTAGGATTTGTCAAGAAGAA
GATGAAGAAACTGATATGGAAGCTCCTTGTGCTTGTAATGGCACTCTCAAATTTGCTCATGGAAATGTATTCAGAAATGGTGCAACAAAA
AAGGTGACATCACCTGTGAAATCTGXTAATAAGGTGTTTTCACCAAACTACACCCTTCCACCGGCAAGAAGCAACCCTGATGTAATGGCA
ATTGATATCAGGCAAGCATGGGGACCGGGCATGGATATTAGAAATCCTCATTTTCTAGCTTTTGCTGCTGCTGAGCGTCAATTCCTGCAA
TCAGAGTATGATGATTATGCCATTGCTAGCAGTGGXGAGTCTAGCATGTTTCCGCTATGTTGCAATCATTTTGATGCTACTCTTGCTGAT
ACGTCAAACCTTGATGGTCACGAGGGACTTTGCAATGGTGCA
Edits in Original Sequence 
CATTGTTTTCTCCTTTTCTCTTTTAGAGAGAGAGAAAAAAAA(5')ATGGTGAATGAGTTTATGGTATGTGTTGATAGGATCATAATAGC
AACAACATGTTTTGGAGATTCATCAGTTACTAATGGTGTTGGTGGGAGAGAAACCCTTTTGACTAATGATGCTGTAAATGTTAATTCTAC
TGTTGAAATCATCAATTCAAGAAAAACCCATCAAGAAAAAATTAGTATTAGTACTAGTACTTGTGTTGGTGGAGAAGGTTCTTCAAAGGG
TAGTAGTAGTAGTAGTGTTAGAGAGTGTAGGATTTGTCAAGAAGAAGATGAAGAAACTGATATGGAAGCTCCTTGTGCTTGTAATGGCAC
TCTCAAATTTGCTCATaGGAAATGTATTCAGAAATGGTGCAACAAAAAAGGTGACATCACCTGTGAAATCTGXTAATAAGGTGTTTTCAC
CAAACTACACCCTTCCACCGGCAAGAAGCAACCCTGATGTAATGGCAATTGATATCAGGCAAGCATGGGGACCGGGCATGGATATTAGAA
ATCCTCATTTTCTAGCTTTTGCTGCTGCTGAGCGTCAATTCCTGCAATCAGAGTATGATGATTATGCCATTGCTAGCAGTGGXGAGTCTA
GCATGTTTCCGCTATGTTGCAATCATTTTGATGCTACTCTTGCTGATACGTCAAACCTTGATGGTCACGAGGGACTTTGCAATGGTGCA
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan