ESTScan Details for Unigene SGN-U327558

Score 
1259
Direction 
Forward
Predicted Peptide Sequence 
MYDFVQVDLSGGYYDAGDNVKFNFPMAYTTTMLSWNTLEYGKRMGAQLQHARAAIRWATDYFLKCANAAPNKLFVGVGDPNADHKCWERP
EDMDTIRSVYYVSPSNPGSDVAGEMAAALAAASLVFRSVDPVYSKKLLGNAVKVFRFAVQYRGSYSDSLGSAACPFYCSYSGYKDELYWG
AAWLLRATNDISYLNLINTLGANDVPDLFSWDNKYAGAHVLMSRRSVVGNDNRFDSFKQRAEDFVCKVLPNSPYTSTQYTKGGLLYKLPE
ENLQYVTSITSLLTTYAKYMATKKHTFNCGSLVVTEKTIRNFAKRQVDYILGNNPMKMSYMVGRGVTTREEXHHRGSSFPSLAMHPQSFG
CEAGFQPFYYTANPTPNILVGAIIGGPNQNDFFPDERTDYIHSEPATYINAAIVGPLAYFDISNH
Predicted Coding Sequence 
ATGTATGATTTTGTGCAGGTGGATTTAAGTGGAGGGTATTATGATGCTGGTGATAATGTCAAGTTCAATTTCCCAATGGCATATACGACG
ACAATGCTGTCGTGGAACACACTTGAGTATGGGAAGAGAATGGGTGCACAATTACAGCATGCACGGGCTGCTATCCGTTGGGCCACTGAT
TACTTTCTAAAATGTGCAAATGCTGCTCCAAACAAGCTATTCGTTGGTGTTGGTGACCCAAATGCTGATCACAAGTGTTGGGAAAGGCCT
GAAGATATGGACACTATACGTAGCGTCTATTATGTGTCTCCCAGTAATCCTGGTTCTGATGTTGCTGGAGAAATGGCTGCTGCTTTAGCT
GCTGCCTCATTAGTTTTCCGATCTGTTGATCCAGTTTACTCGAAAAAACTATTGGGAAATGCAGTCAAAGTGTTTAGGTTTGCAGTTCAA
TACAGAGGGTCTTATAGTGATTCATTAGGCTCTGCAGCTTGCCCATTTTATTGCTCATACTCTGGTTATAAGGATGAGCTATATTGGGGA
GCAGCATGGCTATTGAGAGCAACAAATGACATTTCTTACTTAAACTTGATTAATACATTGGGAGCTAATGATGTACCAGATTTATTCAGC
TGGGACAACAAGTATGCTGGTGCTCATGTTCTTATGTCAAGGAGAAGCGTGGTAGGAAATGACAATAGATTTGATTCATTCAAACAAAGA
GCGGAAGATTTTGTATGTAAAGTACTACCCAACTCACCTTATACAAGCACCCAATATACAAAAGGGGGCTTACTTTACAAGCTACCTGAA
GAAAACCTTCAGTATGTGACATCCATTACTTCTCTGCTCACCACTTATGCCAAATACATGGCAACTAAAAAGCATACTTTCAACTGTGGA
AGCCTTGTCGTTACAGAAAAGACAATTAGAAACTTTGCAAAAAGACAGGTGGACTATATTTTGGGAAATAATCCAATGAAAATGTCATAC
ATGGTTGGTAGGGGAGTAACTACCCGCGAAGAAXTTCACCATAGAGGATCATCTTTCCCTTCTTTGGCAATGCATCCACAATCATTTGGT
TGTGAAGCTGGATTTCAACCATTTTACTACACAGCAAATCCTACCCCTAACATATTAGTGGGAGCTATTATCGGAGGTCCAAATCAAAAT
GATTTCTTCCCAGATGAACGTACTGATTATATTCATTCGGAGCCAGCTACTTACATTAATGCTGCTATTGTGGGCCCTTTAGCATATTTT
GATATTTCCAACCATTAA
Edits in Original Sequence 
ATTAGTATAGTAGAATGAAAGTTTGTGTTTGCCTCATTCTCTTCTTCTCTTTGGGTACTGCCCAATTTGACTATAGAGATGCTCTTGAAA
AGTCCATTTTGTTCTTTGAAGGACAAAGATCAGGCAAACTCCCCCCCAACCAACGACTCTCTTGGAGGGGTAACTCTGGACTTCAAGATG
GTTCACTTGCTAAAGTAACTTTTTTTTTTTTCATTATTATTCTCTCCGTCCTTAATCGTTTATCTATTTTTTTAATAGGATAAATTCACT
ATGTCAATCATTATTATTCAATTAAGAGAGAGAAAGCAGGTTCCAAAGATAATATTTATAGTGTGA
(5')ATGTATGATTTTGTGCAGGT
GGATTTAAGTGGAGGGTATTATGATGCTGGTGATAATGTCAAGTTCAATTTCCCAATGGCATATACGACGACAATGCTGTCGTGGAACAC
ACTTGAGTATGGGAAGAGAATGGGTGCACAATTACAGCATGCACGGGCTGCTATCCGTTGGGCCACTGATTACTTTCTAAAATGTGCAAA
TGCTGCTCCAAACAAGCTATTCGTTGGTGTTGGTGACCCAAATGCTGATCACAAGTGTTGGGAAAGGCCTGAAGATATGGACACTATACG
TAGCGTCTATTATGTGTCTCCCAGTAATCCTGGTTCTGATGTTGCTGGAGAAATGGCTGCTGCTTTAGCTGCTGCCTCATTAGTTTTCCG
ATCTGTTGATCCAGTTTACTCGAAAAAACTATTGGGAAATGCAGTCAAAGTGTTTAGGTTTGCAGTTCAATACAGAGGGTCTTATAGTGA
TTCATTAGGCTCTGCAGCTTGCCCATTTTATTGCTCATACTCTGGTTATAAGGATGAGCTATATTGGGGAGCAGCATGGCTATTGAGAGC
AACAAATGACATTTCTTACTTAAACTTGATTAATACATTGGGAGCTAATGATGTACCAGATTTATTCAGCTGGGACAACAAGTATGCTGG
TGCTCATGTTCTTATGTCAAGGAGAAGCGTGGTAGGAAATGACAATAGATTTGATTCATTCAAACAAAGAGCGGAAGATTTTGTATGTAA
AGTACTACCCAACTCACCTTATACAAGCACCCAATATACAAAAGGGGGCTTACTTTACAAGCTACCTGAAGAAAACCTTCAGTATGTGAC
ATCCATTACTTCTCTGCTCACCACTTATGCCAAATACATGGCAACTAAAAAGCATACTTTCAACTGTGGAAGCCTTGTCGTTACAGAAAA
GACAATTAGAAACTTTGCAAAAAGACAGGTGGACTATATTTTGGGAAATAATCCAATGAAAATGTCATACATGGTTgGGTAGGGGAGTAA
CTACCCGCGAAGAAXTTCACCATAGAGGATCATCTTTCCCTTCTTTGGCAATGCATCCACAATCATTTGGTTGTGAAGCTGGATTTCAAC
CATTTTACTACACAGCAAATCCTACCCCTAACATATTAGTGGGAGCTATTATCGGAGGTCCAAATCAAAATGATTTCTTCCCAGATGAAC
GTACTGATTATATTCATTCGGAGCCAGCTACTTACATTAATGCTGCTATTGTGGGCCCTTTAGCATATTTTGATATTTCCAACCATTAA
(3')CGGTTTATCTAATTGTAATTGTAAATATATCCCTTCATCACCAAAACTTGGTATAGGGATATATACTTACTTCTTAATATATATATA
TATATATATATATGTTCAACGAATGTTTCTTCCCCATCTCAAACTTAATTATGCCAAACCAAAAAAAAAAAAAAAAAAAAAAAACTCGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan