ESTScan Details for Unigene SGN-U327589

Score 
449
Direction 
Forward
Predicted Peptide Sequence 
MTESGPLNLIDDDNSDTEEGVDKQVRNKLAYDLPGXNAQPWKSSYSNKMLENCPDWQELGSCNYRRGLDLFMDESFIFDPTDLDIDLTPE
AVDAALKENQTSRAVILSLRLNEDSLIKKCIIGVSPADIPAVASSVPVKYIQRLVEALASLLENCPHMEFIPDGVRFPIKYKLLALSYLD
MCCTHLSAFNPFACLVGTLQNPRQFYSAEIQKLASCSKIL
Predicted Coding Sequence 
ATGACAGAGAGTGGTCCACTCAATTTGATTGATGATGATAATAGTGACACTGAAGAAGGTGTTGATAAGCAAGTGAGAAATAAATTGGCA
TATGACTTGCCCGGGTXCAATGCCCAACCATGGAAGAGCAGTTATTCGAACAAAATGCTTGAGAATTGCCCCGACTGGCAGGAGTTGGGC
AGCTGCAACTACAGAAGGGGTCTTGATCTATTCATGGATGAGTCTTTTATCTTTGACCCCACTGATCTAGACATAGATCTTACACCAGAA
GCCGTTGATGCAGCACTAAAGGAAAATCAGACTAGTCGTGCAGTGATTCTTAGTCTACGTTTAAATGAAGATAGTTTGATTAAGAAGTGC
ATTATTGGTGTCAGTCCTGCAGATATACCCGCTGTAGCATCCTCAGTCCCTGTTAAATATATTCAGAGATTAGTTGAGGCATTAGCATCT
CTGCTGGAGAACTGCCCACATATGGAGTTTATCCCAGATGGTGTCAGGTTTCCTATCAAATACAAACTCTTGGCTCTTTCTTACCTTGAC
ATGTGTTGTACACATTTGTCAGCTTTTAATCCTTTTGCATGTCTGGTAGGAACTTTGCAAAATCCACGGCAATTCTATTCAGCAGAAATC
CAGAAGCTTGCTTCCTGCTCTAAAATCCTT
Edits in Original Sequence 
TCGCTTCCAGATAACTCACAATCTTTCCTTAGATGGGGTGCTGGATGTTTTGAACTCTAAAAAC(5')ATGACAGAGAGTGGTCCACTCA
ATTTGATTGATGATGATAATAGTGACACTGAAGAAGGTGTTGATAAGCAAGTGAGAAATAAATTGGCATATGACTTGCCCGGGTXCAATG
CCCAACCATGGAAGAGCAGTTATTCGAACAAAATGCTTGAGAATTGCCCCGACTGGCAGGAGTTGGGCAGCTGCAACTACAGAAGGGGTC
TTGATCTATTCtATGGATGAGTCTTTTATCTTTGACCCCACTGATCTAGACATAGATCTTACACCAGAAGCCGTTGATGCAGCACTAAAG
GAAAATCAGACTAGTCGTGCAGTGATTCTTAGTCTACGTTTAAATGAAGATAGTTTGATTAAGAAGTGCATTATTGGTGTCAGTCCTGCA
GATATACCCGCTGTAGCATCCTCAGTCCCTGTTAAATATATTCAGAGATTAGTTGAGGCATTAGCATCTCTGCTGGAGAACTGCCCACAT
ATGGAGTTTATCCtCAGATGGTGTCAGGTTTCCTATCAAATACAAACTCTTGGCTCTTTCTTACCTTGACATGTGTTGTACACATTTGTC
AGCTTTTAATCCTTTTGCATGTCTGGTAGGAACTTTGCAAAATCCACGGCAATTCTATTCAGCAGAAATCCAGAAGCTTGCTTCCTGCTC
TAAAATCCTT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan