ESTScan Details for Unigene SGN-U327667

Score 
416
Direction 
Forward
Predicted Peptide Sequence 
GWKKGTKITFPEKGDYEYGAAPGDLIFVIDEKPHAVFKRDGNDLVTNQKISLLDALTGKTISLTTLDGRELTIPIKEIVKPGQELIIQNE
GMPISKERGKKGNLKIKFDIKFPSRLNADQKSDXQKGAMQEY
Predicted Coding Sequence 
XCAGGTTGGAAGAAAGGCACAAAAATAACTTTTCCAGAGAAAGGGGACTATGAATATGGAGCTGCCCCGGGTGATCTTATTTTTGTGATT
GATGAAAAGCCACATGCTGTCTTCAAGAGGGATGGAAATGATCTAGTCACGAATCAGAAAATATCGTTACTGGATGCTCTCACTGGAAAA
ACTATCAGCTTGACTACTTTGGACGGAAGGGAACTCACAATACCAATCAAAGAAATCGTCAAACCAGGACAGGAGCTGATAATCCAAAAT
GAGGGAATGCCAATATCAAAGGAACGTGGCAAAAAAGGGAATTTGAAGATCAAGTTTGACATTAAATTTCCATCAAGGCTAAATGCAGAT
CAGAAATCTGATXCTCAGAAGGGTGCTATGCAGGAGTATTGA
Edits in Original Sequence 
(5')XCAGGTTGGAAGAAAGGCACAAAAATAACTTTTCCAGAGAAAGGGGACTATGAATATGGAGCTGCCCCGGGTGATCTTATTTTTGT
GATTGATGAAAAGCCACATGCTGTCTTCAAGAGGGATGGAAATGATCTAGTCACGAATCAGAAAATATCGTTACTGGATGCTCTCACTGG
AAAAACTATCAGCTTGACTACTTTGGACGGAAGGGAACTCACAATACCAATCAAAGAAATCGTCAAACCAGGACAGGAGCTGATAATCCA
AAATGAGGGAATGCCAATATCAAAGGAACGTGGCAAAAAAGGGAATTTGAAGATCAAGTTTGACATTAAATTTCCATCAAGGCTAAATGC
AGATCAGAAATCTGATXCTCAGAAGGGTGCTATGCAGGAGTATTGA(3')CTAGTCCTATTTTTAACTTAAGGTGTCACTAACACTATCT
TGGAGTTGCGCGGAATGTAAATATTTAACAAGCTTTCTGTAGAAATGAAATTGTACATATTAGGATATAATCTTAAGGATGCGTTCCAAC
ATTTACAAATAGTAAGCACCAAAAGAGGAGCTAATGTAGCTACTTCTTTAGCTGCTTGCATTTTCTTTTGTTGGATGTAAAAGGAGTAAG
TAGTTTAATAGCTGTGTTGTTTGATTTGGAGGTGGATACTATATATTAAGTATTGTAGTTGCGAGTAGTGGCTCTAAAAAAAAAAAAAAA
AA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan