ESTScan Details for Unigene SGN-U327677

Score 
423
Direction 
Forward
Predicted Peptide Sequence 
MDYEPYDSSGTDDDLPPSHQNRIPRGSGRITGNGRSAVIGSVPYQRMYGETDMEAQIHQLEQEAYISVLRAFKAQADAISWEKESLITE
Predicted Coding Sequence 
ATGGACTACGAGCCCTACGATAGCAGTGGAACTGATGATGATCTTCCTCCATCACATCAAAATAGGATTCCAAGAGGTAGCGGACGCATT
ACTGGAAATGGAAGATCTGCTGTCATTGGTTCTGTCCCCTACCAGAGGATGTACGGTGAAACAGACATGGAGGCCCAAATTCACCAACTT
GAGCAAGAAGCATACATTTCAGTTCTAAGAGCTTTTAAAGCTCAAGCTGATGCCATTTCATGGGAGAAAGAAAGCTTGATAACTGAG
Edits in Original Sequence 
CGGATTTCAAATCCTAATATTAAACTAAATATTAAAAACCCGTTTCACATCCGCCTTCTCAAACTCATACTCTCCCTTCTTCCACCTCAC
ATTTGCCCCCAATTGATTTGCGAACTTGTAAAACCCTAACCCTTAATCTTGCAATCCACACGCCGCCGCTGCAGCAGTCGCCGCTGCTGT
GGTTCTTTCGTTTTCTGTTTGGTTTTGAGTTCAATTTGATTTCATATATTCTTGGTTTCGCTCTATTCTATTCGGTTCTTCAAGTTACAG
ATTAAGAGCTGGCT
(5')ATGGACTACGAGCCCTACGATAGCAGTGGAACTGATGATGATCTTCCTCCATCACATCAAAATAGGATTCCA
AGAGGTAGCGGACGCATTACTGGAAATGGAAGATCTGCTGTCATTGGTTCTGTCCCCTACCAGAGGATGTACGGTGAAACAGACATGGAG
GCCCAAATTCACCAACTTGAGCAAGAAGCATACATTTCAGTTCTAAGAGCTTTTAAAGCTCAAGCTGATGCCATTTCATGGGAGAAAGAA
AGCTTGATAACTGAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan