Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U327679

Score 
328
Direction 
Forward
Predicted Peptide Sequence 
RAGQLEEARELIKAMPMEPNSGVWGALWELVGFMQEGGKMFWGKEINKTKIAEKGPSRSWIEGKEGVIHEFYAGDMTHPNSKEIKEALED
LIGRLKSHGYEPNLSSVPYDLNEEHKRRILLTHSEKLALAYGLLITDSAGSTIKIMKNQESVKIATPSWAGASQITGREIIVRDNKRFHH
FRNGDALVVTSGXLIDEPLRSLKSQCMLFEESFSFGNXTLLGNSATIHNCEELDFLVDRSLKDMINSFRGKSEFQNCEIPGAKLLTGPFS
ATYRVREVQAKFKASLGSKHGARPGTXITGILLAKTCLTKFSGKLVAAKAEKGNSKVAXSVVLEDSTPVAIRLKFLFQNYISEDXDMSGQ
FFMILCPTPQPIRYRRQGRSDVVNELEFFEAISYFHKAEHRAGI
Predicted Coding Sequence 
XGCAGGGCTGGGCAACTAGAAGAGGCTCGTGAGCTTATCAAAGCTATGCCAATGGAGCCTAATAGTGGTGTCTGGGGTGCCCTCTGGGAG
CTTGTCGGATTCATGCAGGAAGGTGGGAAGATGTTTTGGGGTAAGGAAATCAATAAAACAAAAATTGCTGAGAAAGGCCCTTCACGCAGC
TGGATTGAAGGCAAAGAGGGGGTGATTCATGAATTCTATGCTGGTGATATGACCCACCCAAATTCTAAAGAGATTAAGGAAGCACTTGAG
GATCTTATTGGTCGGCTTAAGTCACATGGATACGAGCCAAATTTAAGCTCTGTACCTTATGATCTGAATGAAGAACATAAAAGGAGAATA
CTTCTCACACATAGTGAGAAGCTGGCTTTGGCATATGGGCTGCTCATCACTGATTCTGCTGGGTCTACCATCAAGATCATGAAAAATCAA
GAATCTGTGAAGATTGCCACTCCTTCATGGGCXGGTGCATCTCAAATCACTGGCAGGGAGATCATTGTCAGGGATAACAAGAGATTTCAC
CATTTCCGTAATGGTGATGCTCTTGTGGTAACTTCTGGTAAXTTGATAGATGAACCGTTAAGATCTCTTAAATCCCAGTGTATGTTGTTT
GAAGAATCCTTTTCATTTGGAAATGXTACATTGCTCGGTAACAGTGCCACAATACACAATTGTGAGGAATTGGACTTCTTAGTCGACCGA
AGCCTGAAGGATATGATTAATTCATTCAGGGGAAAATCTGAGTTCCAGAATTGTGAAATTCCAGGTGCCAAGTTATTAACAGGTCCATTC
TCCGCCACTTACAGGGTGAGGGAAGTGCAAGCAAAGTTCAAGGCATCTTTGGGTTCTAAACATGGGGCAAGACCTGGAACAXTTATTACT
GGCATTTTGCTTGCTAAAACTTGTTTGACAAAGTTCAGCGGGAAGCTTGTTGCAGCAAAAGCTGAAAAAGGCAATTCCAAAGTAGCAXCC
TCTGTGGTTTTAGAAGATTCGACGCCGGTAGCTATTAGACTGAAGTTCTTATTTCAAAATTATATATCTGAAGATGXTGATATGTCCGGT
CAATTTTTCATGATACTCTGTCCAACTCCCCAGCCCATTCGTTACAGGAGGCAGGGGCGTTCCGATGTGGTTAATGAACTAGAATTTTTT
GAAGCAATTTCATACTTCCACAAGGCCGAGCATAGAGCTGGTATATAA
Edits in Original Sequence 
(5')XGCAGGGCTGGGCAACTAGAAGAGGCTCGTGAGCTTATCAAAGCTATGCCAATGGAGCCTAATAGTGGTGTCTGGGGTGCCCTgCT
GGGAGCTTGTCGGATTCATGCAGGAAGGTGGGAAGATGTTTTaGGGGTAAGGAAATCAATAAAACAAAAATTGCTGAGAAAGGaCCCTTC
ACGCAGCTGGATTGAAGGCAAAGAGGGGGTGATTCATGAATTCTATGCTGGTGATATGACCCACCCAAATTCTAAAGAGATTAAGGAAGC
ACTTGAGGATCTTATTGGTCGGCTTAAGTCACATGGATACGAGCCAAATTTAAGCTCTGTACCTTATGATCTGAATGAAGAACATAAAAG
GAGAATACTTCTCACACATAGTGAGAAGCTGGCTTTGGCATATGGGCTGCTCATCACTGATTCTGCTGGGTCTACCATCAAGATCATGAA
AAATCtAAGAATCTGTGAAGATTGCCACTCCTTCATGGGCXGGTGCATCTCAAATCACTGGCAGGGAGATCATTGTCAGGGATAACAAGA
GATTTCACCATTTCCGTAATGGTGtATGCTCTTGTGGTAACTTCTGGTAAXTTGATAGATGAACCGTTAAGATCTCTTAAATCCCAGTGT
ATGTTaGTTTGAAGAATCCTTTTCATTTGGAAATGXTACATTGCTCGGTAACAGTGCCACAATACACAATTGTGAGGAATTGGACTTCTT
AGTCGACCGAAGCCTGAAGGATATGATTAATTCATTCAGGGGAAAATCTGAGTTCCAGAATTGTGtAAATTCCAGGTGCCAAGTTATaTA
ACAGGTCCATTCTCCGCCACTTACAGGGTGAGGGAAGTGCAAcGCAAAGTTCAAGGCATCTTTGGGTTCTAAACATGGGGCAAGACCTGG
AACAXTTATTACTGGCATTTTGCTTGCTAAAACTTGTTTGACAAAGTTCAGCGGGAAGCTTGTTGCAGCAAAAGaCTGAAAAAGGCAATT
CCAAAGTAGCAXCCTCTGTGGTTTTAGAAGATTCGACGCCGGTAGCTATTAGACTGAAGTTCTTATTTCAAAATTATATATCTGAAGATG
XTGATATGTCCGGTCAATTTTTCATGATACTCTGTCCAACTCCCCAGCCCATTCGTTACAGGAGGCAGGGGCGTTCCGATGTGGTTAATG
AACTAGAATTTTTTGAAGCAATTTCATACTTCCACAAGGCCGAGCATAGAGCTGGTATATAA(3')CTTCCATCTTTAGCAGTCCAATTT
TCACTCTTTGTAAATCTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan