ESTScan Details for Unigene SGN-U327880

Score 
426
Direction 
Forward
Predicted Peptide Sequence 
RFYEPSSGRVIIDGKDIRKYNLKSLRRHIAVVPQEPCLFATTIYENIAYGHESATEAEITEAATLANAHKFISALPDGYKTFVGERGVQL
SGGQKQRIAIARAFLRKAELMLLDEATSALDAESERCVQEALDRACAGKTTIIVAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNYSD
GIYARMIQLQRFTHGEAVNMATGSTSSSRPKEDLD
Predicted Coding Sequence 
AGGTTCTACGAGCCATCATCCGGACGTGTCATCATCGATGGCAAGGATATTCGTAAGTACAACCTTAAATCCTTGAGAAGACACATTGCT
GTAGTGCCACAAGAACCTTGCCTCTTTGCTACCACCATCTATGAAAACATCGCGTATGGACACGAGTCAGCAACCGAAGCTGAGATAACC
GAAGCAGCAACCTTGGCAAACGCCCACAAGTTCATATCTGCATTGCCTGATGGATACAAAACATTCGTCGGAGAAAGGGGAGTTCAATTG
TCCGGTGGACAAAAGCAAAGAATCGCCATTGCTCGTGCTTTCCTAAGGAAAGCTGAGCTAATGCTGCTAGACGAAGCAACAAGTGCACTC
GATGCAGAGTCCGAAAGATGTGTACAAGAAGCATTGGATCGCGCTTGTGCAGGTAAGACCACTATTATTGTTGCACATAGGCTATCTACA
ATCAGAAATGCACATGTGATCGCGGTCATAGACGATGGGAAAGTAGCAGAACAAGGTTCTCATTCTCATCTGCTGAAAAACTACTCAGAT
GGTATTTATGCGCGTATGATACAACTACAACGATTTACACATGGAGAAGCTGTGAATATGGCAACAGGATCAACGTCTTCTTCGCGTCCT
AAGGAAGATCTAGATTGA
Edits in Original Sequence 
(5')AGGTTCTACGAGCCATCATCCGGACGTGTCATCATCGATGGCAAGGATATTCGTAAGTACAACCTTAAATCCTTGAGAAGACACAT
TGCTGTAGTGCCACAAGAACCTTGCCTCTTTGCTACCACCATCTATGAAAACATCGCGTATGGACACGAGTCAGCAACCGAAGCTGAGAT
AACCGAAGCAGCAACCTTGGCAAACGCCCACAAGTTCATATCTGCATTGCCTGATGGATACAAAACATTCGTCGGAGAAAGGGGAGTTCA
ATTGTCCGGTGGACAAAAGCAAAGAATCGCCATTGCTCGTGCTTTCCTAAGGAAAGCTGAGCTAATGCTGCTAGACGAAGCAACAAGTGC
ACTCGATGCAGAGTCCGAAAGATGTGTACAAGAAGCATTGGATCGCGCTTGTGCAGGTAAGACCACTATTATTGTTGCACATAGGCTATC
TACAATCAGAAATGCACATGTGATCGCGGTCATAGACGATGGGAAAGTAGCAGAACAAGGTTCTCATTCTCATCTGCTGAAAAACTACTC
AGATGGTATTTATGCGCGTATGATACAACTACAACGATTTACACATGGAGAAGCTGTGAATATGGCAACAGGATCAACGTCTTCTTCGCG
TCCTAAGGAAGATCTAGATTGA(3')GAAAAAAAACGCGAATTGAAGCTCAAAATGAAAATACCACTAGAAAAAAAAAGAAAGAGGAGTA
TACCTTGTGTAACACCCTTATTATTTTTTGGACTGCTAATTTCTTGTTCACTGTTGCTAGTATAGTATAGTATAATATGTGCATTAATCC
AAAATTTATATTTATCCTTCAATCTTTCACTCTTTTTCTCTGAGAACACACCAAAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan