ESTScan Details for Unigene SGN-U327940

Score 
457
Direction 
Forward
Predicted Peptide Sequence 
IGVFFTRIRVNFSSSKGLTLVGKFVGQQQQLFLDSNAHXTVLDDLKYTVLQEGEIESSFSDIHMEMLRYFGGFCDTEWHTDWRSQKELPK
SYSQTMECNKDEAFRAKKIAERKFEQKDYAGAKKFALKAQVLYPGLDDLTQMLTTFDVYISAENKVSGEVDWYGVLGVSPSSDDETVKKQ
YRKLALVLHPDKNKSIGAEGAFQLLSEAWSLLSDXIQKVGIYPDKEFKRSP
Predicted Coding Sequence 
XXCATAGGGGTTTTTTTCACAAGAATACGGGTAAATTTTAGTTCTTCAAAGGGTCTGACTTTGGTGGGAAAATTTGTAGGTCAGCAACAG
CAGCTTTTTTTGGATTCAAATGCTCATXATACGGTATTGGATGATTTGAAGTATACTGTGCTTCAAGAAGGGGAGATTGAGTCATCATTT
TCTGATATTCACATGGAAATGCTTAGATATTTTGGTGGTTTCTGTGATACCGAGTGGCATACTGACTGGAGATCACAAAAGGAACTTCCA
AAATCATATTCACAAACTATGGAGTGTAATAAAGATGAAGCCTTCAGAGCAAAAAAAATTGCAGAGCGGAAGTTTGAACAGAAGGATTAT
GCTGGTGCAAAGAAATTTGCCTTGAAAGCTCAGGTTTTGTATCCAGGGCTTGACGATTTAACCCAGATGTTAACAACATTTGATGTTTAC
ATCTCTGCCGAAAACAAAGTAAGTGGGGAAGTGGATTGGTATGGGGTACTTGGTGTGAGCCCGTCAAGTGATGATGAAACGGTAAAGAAA
CAGTACAGGAAGCTAGCTCTTGTCCTCCACCCTGATAAAAATAAATCTATTGGTGCTGAAGGTGCATTTCAACTTCTCTCTGAGGCCTGG
AGCTTGTTATCTGATAAXATCCAAAAGGTTGGCATATACCCAGACAAGGAGTTCAAAAGGTCCCCX
Edits in Original Sequence 
(5')XXCATAGGGGTTTTTTTCACAAGAATACGGGTAAATTTTAGTTCTTCAAAGGGTCTGACTTTGGTGGGAAAATTTGTAGGTCAGCA
ACAGCAGCTTTTTTTGGATTCAAATGCTCATXATACGGTATTGGATGATTTGAAGTATACTGTGCTTCAAGAAGGGGAGATTGAGTCATC
ATTTTCTGATATTCACATGGAAATGCtTTAGATATTTTGGTGGTTTCTGTGATACCGAGTGGCATACTGACTGGAGATCACAAAAGGAAC
TTCCAAAATCATATTCACAAACTATGGAGTGTAATAAAGATGAAGCCTTCAGAGCAAAAAAAATTGCAGAGCGGAAGTTTGAACAGAAGG
ATTATGCTGGTGCAAAGAAATTTGCCTTGAAAGCTCAGGTTTTGTATCCAGGGCTTGACGATTTAACCCAGATGTTAACAACATTTGATG
TTTACATCTCTGCCGAAAACAAAGTAAGTGGGGAAGTGGATTGGTATGGGGTACTTGGTGTGAGCCCGTCAAGTGATGATGAAACGGTAA
AGAAACAGTACAGGAAGCTAGCTCTTGTCCTCCACCCTGATAAAAATAAATCTATTGGTGCTGAAGGTGCATTTCAACTTCTCTCTGAGG
CCTGGAGCTTGTTATCTGATAAXATCCAAAAGGTTGGCATATACCCAGACAAGGAGTTCAAAAGGTCCCCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan