ESTScan Details for Unigene SGN-U327987

Score 
740
Direction 
Forward
Predicted Peptide Sequence 
PNLGKVESLVLVNISHNHFHGNLPSTGAFLAINSSAVVGNQLCARGDDITSGLTLVNAQEKLNLVVLLDISSWNTSFASILALVIVFTQR
RRELKVKKVESSTQNGNNWEIQFFDSKASKSITLDDILGIGEFYSEISNMQMFVKKLNVNIIPTSFWTNIQEIGNIRHPNIVKILAACKS
EKGGILVYEYVEGKDLSEVIGVMSWERRQKVAIGIARALKYLHSSCSPPFSSVNFLPGKXIIDGKDEPRLRLSLPTTTAYVAPEYNGISE
KSDIYGFGLVLIELLTGKNSGDAEFGKRESIVDWARYCYSECHLETWIEPLLKSDAVNNQNKMVEMMNVALQCTASEPAARPCASDVAKT
LDSFGRSNSCGLGLKRCGSV
Predicted Coding Sequence 
CCTAATTTAGGGAAAGTTGAATCACTAGTGTTGGTTAACATCTCTCACAACCACTTCCATGGGAATTTACCGTCCACCGGAGCTTTCCTA
GCTATAAATTCAAGTGCGGTAGTTGGAAACCAACTATGTGCCCGTGGAGACGACATTACAAGCGGCTTAACCCTTGTAAATGCTCAAGAA
AAGCTCAATTTGGTGGTTCTTCTTGACATTTCTTCTTGGAATACTAGTTTTGCTAGTATTTTGGCTTTAGTCATTGTATTTACTCAAAGA
AGAAGAGAATTGAAGGTGAAGAAAGTGGAGAGTAGTACTCAGAATGGTAATAATTGGGAAATACAATTCTTCGATTCAAAAGCCTCGAAA
TCCATCACCCTAGATGACATCTTAGGGATTGGAGAGTTTTATTCCGAAATAAGTAACATGCAAATGTTCGTGAAGAAGTTGAATGTGAAT
ATTATTCCAACAAGTTTTTGGACAAACATCCAAGAAATAGGAAATATTCGACATCCAAATATTGTGAAGATATTGGCTGCATGCAAATCG
GAGAAAGGCGGTATTTTGGTTTATGAGTATGTAGAAGGTAAAGATTTGAGTGAAGTGATTGGAGTGATGAGTTGGGAACGTAGACAAAAA
GTTGCTATTGGCATAGCTAGAGCATTGAAATATTTGCATTCTTCTTGTTCACCACCATTTTCATCGGTGAACTTTCTTCCCGGAAAGTTX
ATCATTGACGGAAAAGATGAGCCTCGTCTGAGATTGAGTCTTCCCACCACTACCGCGTACGTTGCTCCAGAATACAATGGAATATCGGAG
AAGAGTGATATATATGGATTTGGGCTTGTTTTGATAGAGTTATTGACTGGAAAAAATAGCGGTGATGCTGAATTTGGGAAACGTGAGAGT
ATAGTTGATTGGGCGCGATATTGCTACTCAGAATGTCATTTGGAGACATGGATTGAACCATTATTGAAGAGTGACGCAGTGAATAATCAG
AATAAAATGGTGGAGATGATGAATGTGGCTCTTCAATGTACTGCTAGTGAGCCAGCAGCAAGGCCTTGTGCTAGTGATGTTGCAAAGACA
TTGGACTCTTTTGGGAGATCAAATTCTTGTGGTTTAGGGTTGAAAAGGTGTGGTAGTGTTTAG
Edits in Original Sequence 
(5')CCTAATTTAGGGAAAGTTGAATCACTAGTGTTGGTTAACATCTCTCACAACCACTTCCATGGGAATTTACCGTCCACCGGAGCTTT
CCTAGCTATAAATTCAAGTGCGGTAGTTGGAAACCAACTATGTGCCCGTGGAGACGACATTACAAGCGGCTTAACgCCTTGTAAATcGCT
CAAGAAAAGCTCAATTTGGTGGTTCTTCTTGACATTTCTTCTTGGAATACTAGTTTTGCTAGTATTTTcGGCTTTAGTCATTGTATTTAC
TCAAAGAAGAAGAGAATTGAAGGTGAAGAAAGTGGAGAGTAGTACTCAGAATGGTAATAATTGGGAAATACAATTCTTCGATTCAAAAGC
CTCGAAATCCATCACCCTAGATGACATCTTAGGGATTGGAGAGTTTTATTCCGAAATAAGTAACATGCAAATGTTCGTGAAGAAGTTGAA
TGTGAATATTATTCCAACAAGTTTTTGGACAAACATCCAAGAAATAGGAAATATTCGACATCCAAATATTGTGAAGATATTGGCTGCATG
CAAATCGGAGAAAGGCGGTATTTTGGTTTATGAGTATGTAGAAGGTAAAGATTTGAGTGAAGTGATTGGAGTGATGAGTTGGGAACGTAG
ACAAAAAGTTGCTATTGGCATAGCTAGAGCATTGAAATATTTGCATTCTTCTTGTTCACCACCATTTTCATCGGTGAACTTTCTTCCCGG
AAAGTTXATCATTGACGGAAAAGATGAGCCTCGTCTGAGATTGAGTCTTCCCACCACTACCGCGTACGTTGCTCCAGAATACAATGGAAT
ATCGGAGAAGAGTGATATATATGGATTTGGGCTTGTTTTGATAGAGTTATTGACTGGAAAAAATAGCGGTGATGCTGAATTTGGGAAACG
TGAGAGTATAGTTGATTGGGCGCGATATTGCTACTCAGAATGTCATTTGGAGACATGGATTGAACCATTATTGAAGAGTGACGCAGTGAA
TAATCAGAATAAAATGGTGGAGATGATGAATGTGGCTCTTCAATGTACTGCTAGTGAGCCAGCAGCAAGGCCTTGTGCTAGTGATGTTGC
AAAGACATTGGACTCTTTTGGGAGATCAAATTCTTGTGGTTTAGGGTTGAAAAGGTGTGGTAGTGTTTAG(3')ATTTTGGGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan