Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U328049

Score 
451
Direction 
Forward
Predicted Peptide Sequence 
GYVSTQVKGTMGYMDPEYYTTQQLTEKSDVYSFGVLLLELITARSPIVRGKYIVKELRQAIDKSKDMYNIDEFVDPAIPSNMTPISFRKF
VDLAFMCLEDAGANRPTMGEVVKEIENIMEIDGLNSCAESRSTSVSHEGTSATFDHPYSEXKPKSLQWGHQFAININSSHGTRCIVIEME
SHSSNCCAFVLAVYTLCTSVICGGVNSLILEMIKNPSKDLHKQPCMFQLFASDNPGADSVDSK
Predicted Coding Sequence 
GGCTATGTCAGCACTCAGGTTAAAGGAACAATGGGCTACATGGATCCAGAGTACTACACAACACAACAGTTGACTGAGAAGAGTGATGTA
TATAGCTTTGGAGTTCTGCTGCTGGAGCTTATAACAGCACGGAGTCCTATTGTGAGAGGAAAATACATTGTGAAGGAATTGAGGCAAGCA
ATAGACAAGTCTAAAGACATGTACAACATTGATGAGTTTGTTGATCCTGCTATCCCCTCAAACATGACACCTATAAGCTTCAGGAAGTTT
GTTGATCTAGCTTTCATGTGCCTCGAAGATGCAGGAGCTAATAGGCCAACAATGGGTGAGGTAGTGAAAGAGATTGAGAATATCATGGAA
ATAGATGGATTGAACAGTTGCGCTGAATCTAGATCAACTTCTGTGAGCCACGAAGGAACCAGCGCAACCTTTGATCATCCTTACAGTGAG
GAXAAGCCTAAATCGTTACAATGGGGTCACCAATTCGCGATAAACATCAACTCTTCTCATGGAACCAGGTGCATTGTCATAGAAATGGAA
AGTCATTCAAGCAACTGTTGTGCTTTTGTGTTAGCTGTGTACACTCTGTGCACCTCTGTCATATGTGGCGGCGTAAATAGCCTTATACTA
GAAATGATCAAAAATCCATCTAAGGATCTTCATAAACAGCCTTGTATGTTTCAACTGTTTGCTTCTGATAATCCAGGAGCTGACTCCGTG
GATTCAAAATGA
Edits in Original Sequence 
(5')GGCTATGTCAGCACTCAGGTTAAAGGAACAATGGGCTACATGGATCCAGAGTACTACACAACACAACAGTTGACTGAGAAGAGTGA
TGTATATAGCTTTGGAGTTCTGCTGCTGGAGCTTATAACAGCACGGAGTCCTATTGTGAGAGGAAAATACATTGTGAAGGAATTGAGGCA
AGCAATAGACAAGTCTAAAGACATGTACAACATTGATGAGTTTGTTGATCCTGCTATCCCCTCAAACATGACACCTATAAGCTTCAGGAA
GTTTGTTGATCTAGCTTTCATGTGCCTCGAAGATGCAGGAGCTAATAGGCCAACAATGGGTGAGGTAGTGAAAGAGATTGAGAATATCAT
GGAAATAGATGGATTGAACAGTTGCGCTGAATCTAGATCAACTTCTGTGAGCCACGAAGGAACCAGCGCAACCTTTGATCATCCTTACAG
TGAGGAXAAGCCTAAATCGTTACAATGGGGTCACCAATTCGCGATAAACATCAACTCTTCTCATGGAACCAGGTGCATTGTCATAGAAAT
GGAAAGTCATTCAAGCAACTGTTGTGCTTTTGTGTTAGCTGTGTACACTCTGTGCACCTCTGTCATATGTGtGCGGCGTAAATAGCCTTA
TACTAGAAATGAtTCAAAAATCCATCTAAGGATCTTCATAAACAGCCTTGTATGTTTCAACTGTTTGCTTCTGATAATCCAGGAGCTaGA
CTCCGTGGATTCAAAATGA(3')GTGATTTTATTGTATTTTGGACTTTTAGTCACTCATTAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan