ESTScan Details for Unigene SGN-U328088

Score 
853
Direction 
Forward
Predicted Peptide Sequence 
MDHQKLGTTNIMSPPSVPNHYKKFHDQEKRHDFQTQQPYLVYSPVVKPNNNPIDSVSHVFNSWTNKADTMARNVWRNLKTGPSVSEAACG
KLKLTAKALTEGGFEPLYKQIFATDPNEQLKKTFACYLSTITGPVAGTLYLSSTKLAFCSDRPLSFRAPSGHEAWSYYKVAIPLANIGSV
NPVVMRENPSERYIQIVTIDGHDFWFMGLINFEKAKHHVLETLSHFRGQPYGGY
Predicted Coding Sequence 
ATGGATCATCAAAAATTAGGCACCACCAATATTATGAGTCCTCCATCAGTCCCAAATCACTATAAAAAATTTCATGATCAAGAAAAGAGA
CATGATTTTCAAACTCAACAACCTTACCTTGTGTATTCCCCTGTTGTTAAGCCTAACAACAATCCAATTGACTCTGTTTCTCATGTCTTC
AATTCTTGGACTAACAAAGCTGACACTATGGCCCGTAACGTCTGGCGTAACTTGAAAACTGGTCCATCAGTATCAGAAGCAGCATGTGGT
AAACTCAAATTGACAGCCAAGGCATTGACAGAAGGTGGATTTGAACCACTTTACAAGCAGATTTTTGCAACAGATCCAAATGAACAGTTG
AAGAAGACATTTGCTTGTTATCTTTCTACAATAACTGGTCCTGTTGCTGGAACTCTTTATTTGTCATCAACCAAACTGGCCTTTTGTAGT
GATCGTCCCTTATCTTTTCGAGCTCCATCGGGACACGAAGCTTGGAGCTACTATAAGGTGGCAATACCATTGGCAAACATTGGAAGTGTC
AATCCAGTAGTGATGAGAGAAAATCCATCAGAAAGGTACATTCAAATTGTCACAATAGATGGTCATGATTTTTGGTTCATGGGGTTGATT
AATTTTGAGAAAGCAAAGCATCATGTCCTAGAGACTTTATCACATTTTAGAGGCCAACCTTATGGTGGATATTGA
Edits in Original Sequence 
CTTTTACAACCTTTTTTCTTGTGTGAATAATAAAAATTTGATCATTTTATTTCAT(5')ATGGATCATCAAAAATTAGGCACCACCAATA
TTATGAGTCCTCCATCAGTCCCAAATCACTATAAAAAATTTCATGATCAAGAAAAGAGACATGATTTTCAAACTCAACAACCTTACCTTG
TGTATTCCCCTGTTGTTAAGCCTAACAACAATCCAATTGACTCTGTTTCTCATGTCTTCAATTCTTGGACTAACAAAGCTGACACTATGG
CCCGTAACGTCTGGCGTAACTTGAAAACTGGTCCATCAGTATCAGAAGCAGCATGTGGTAAACTCAAATTGACAGCCAAGGCATTGACAG
AAGGTGGATTTGAACCACTTTACAAGCAGATTTTTGCAACAGATCCAAATGAACAGTTGAAGAAGACATTTGCTTGTTATCTTTCTACAA
TAACTGGTCCTGTTGCTGGAACTCTTTATTTGTCATCAACCAAACTGGCCTTTTGTAGTGATCGTCCCTTATCTTTTCGAGCTCCATCGG
GACACGAAGCTTGGAGCTACTATAAGGTGGCAATACCATTGGCAAACATTGGAAGTGTCAATCCAGTAGTGATGAGAGAAAATCCATCAG
AAAGGTACATTCAAATTGTCACAATAGATGGTCATGATTTTTGGTTCATGGGGTTGATTAATTTTGAGAAAGCAAAGCATCATGTCCTAG
AGACTTTATCACATTTTAGAGGCCAACCTTATGGTGGATATTGA(3')AATGTATGCCTATTTGTTTTGTTCCTCTATGTATTTGGAAGA
GATATAATAAATGTACCATTACTATTAAGTTTCTCTGGTTCAGATTAATTATCGTGTTTCTCTTTTCCACGTAAAAAAAAAAAAAAAAAA
GAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan