ESTScan Details for Unigene SGN-U328094

Score 
259
Direction 
Reverse
Predicted Peptide Sequence 
MDHRSLQYVFTQKDLNLRQRRSMELLKDYDITILYHPGKANVVADALSRKAGSMGSLAHLQVSRCPLAREVQTLANDLMRLELNEKGEFL
ACVEARSSFLDKIKGKQFTDEKLIWIRDKVMRGEAKEAKIDKEGVLRIKGKVCVPRADDLIHTILTEX
Predicted Coding Sequence 
ATGGATCATCGTAGTTTACAGTATGTCTTTACTCAGAAAGATTTGAATTTGAGACAGAGGAGATCGATGGAGCTACTGAAGGACTATGAT
ATCACTATCTTGTATCATCCGGGAAAGGCTAATGTTGTGGCAGATGCTTTAAGTAGAAAGGCAGGGAGCATGGGAAGTCTAGCTCACTTG
CAGGTTTCTAGATGCCCATTGGCTAGAGAGGTTCAGACTCTGGCTAATGACCTTATGAGGCTAGAATTAAATGAGAAGGGAGAATTTTTG
GCTTGTGTGGAGGCAAGATCTTCCTTTCTTGATAAGATTAAAGGAAAGCAGTTTACCGATGAGAAACTGATCTGGATTCGAGATAAGGTA
ATGCGAGGAGAGGCTAAAGAAGCAAAAATCGATAAGGAAGGTGTTTTGAGGATTAAGGGAAAGGTATGTGTACCCCGTGCCGACGATTTG
ATTCACACTATTCTTACAGAGGXX
Edits in Original Sequence 
GCAATTAAAGGTGCATGAACGTAATTATCCGACCCATGATTTGGAGTTAGCGGCAGTAGTGATTGCATTAAAGTAATAGAGACATTATCT
CTATGGGGTTAAGTGTGAAGTCTAT
(5')ATGGATCATCGTAGTTTACAGTATGTCTTTACTCAGAAAGATTTGAATTTGAGACAGAGGA
GATCGATGGAGCTACTGAAGGACTATGATATCACTATCTTGTATCATCCGGGAAAGGCTAATGTTGTGGCAGATGCTTTAAGTAGAAAGG
CAGGGAGCATGGGAAGTCTAGCTCACTTGCAGGTTTCTAGATGCCCATTGGCTAGAGAGGTTCAGACTCTGGCTAATGACCTTATGAGGC
TAGAATTAAATGAGAAGGGAGAATTTTTGGCTTGTGTGGAGGCAAGATCTTCCTTTCTTGATAAGATTAAAGGAAAGCAGTTTACCGATG
AGAAACTGATCTGGATTCGAGATAAGGTAATGCGAGGAGAGGCTAAAGAAGCAAAAATCGATAAGGAAGGTGTTTTGAGGATTAAGGGAA
AGGTATGTGTACCCCGTGCCGACGATTTGATTCACACTATTCTTACAGAGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan