ESTScan Details for Unigene SGN-U328119

Score 
43
Direction 
Forward
Predicted Peptide Sequence 
MDXLTPRYIEGLHYFSCHCGVVYCSTNSHAARPFFLLTRADSTIHMGFEQVSDLTGLLLSKEQSHGKDRALLGHLLILPSSRFVLPLTGC
KSWQQIYRAI
Predicted Coding Sequence 
ATGGATAXATTAACTCCTCGTTACATTGAGGGTCTACACTATTTCAGCTGCCACTGTGGGGTTGTCTACTGCAGTACTAATAGTCATGCA
GCAAGGCCTTTTTTTTTACTAACCAGAGCTGACTCAACCATACATATGGGTTTTGAACAGGTCAGTGATTTAACAGGACTGCTTCTTTCG
AAAGAGCAAAGCCATGGGAAAGATAGAGCATTATTAGGACACTTGCTGATTCTTCCTTCTAGTCGGTTTGTTTTACCTCTTACTGGTTGC
AAGTCTTGGCAACAGATATATAGAGCAATATAG
Edits in Original Sequence 
GTTGAAGGGCTTTTATGAACTCAAACATCTTGCTTTTGGTTTGTAAGACTGAAGAGTTAAACTTATTTTAAGATCTAAATTAAGTTCCTC
TCTTTTTGTTTTTTGGATGTGAAATATTGTTGCTCTTGCTAATTCTCTCTTTATATATACACATATCGATTTAGTTACTTAATGATAAAT
GTCATATATATTTGAGTTTGGGTACTTCATTGTAACAATGATATCTGTTTGTGTAGAAGGATGATATAGAAATCCGTTAATCAGATGGCA
TGGATCCAAGGAAAAGAACATTGTGAGTCTACTTGCAGCAATGTGATTTCTCTTACATATTTCTGTGAACTTTCGACGGCCTTAACCCAC
AACTAGAGAGATTTGCAGTTTCCAAAAGCTCTTGTTAGTTGTTAGGGAATAGTGTGGTTTAACTTCTCTGAGTAGCTTTCCAGTTTGTTT
GCCTATGTATGTTATTTCTTGATTTCTTTTTTTCTTGTATTAGCATATGTATCTACAGGTAAGAGAGGGAGGGAGCAGTTAAAGTTCTTC
TGCTTACTATGTTCACGGAACAGCCAAACGTGCTGTGATGTCTGTAGTTACAACCTGTGGGTTCATATTCAGTTGAAAACCTCAGTTATG
CTTGGGTGAATGAAGATTTTATCAGTAGTGGGTGATTACG
(5')ATGGATAXATTAACTCCTCgGTTACATTGAGGGTCTACACTATTTC
AGCTGCCACTGTGGGGTTGTCTACTGCAGTACTAATAGTCATGCAGCAAGGCCTTTTTTTTTACTAACCAGAGCTGACTCAACCATACAT
ATGGGTTTTGAACAGGTCAGTGATTTAACAGGACTGaCTTCTTTCGAAAGAGCAAAGCCATGGGAAAGATAGAGCATTATTAGGACACTT
GCTGATTCTTCCTTCTAGTCGGTTTGTTTTACCTCTTACTGGTTGCAAGTCTTGcGCAACAGATATATAGAGCAATATAG(3')TGTAAG
ATAGTTTTACCATTTTTCAGACCCTCGCCATTTCACTTGTTACTGTGGAAATGAATTACAGCATTATGTTTGATATAAAAAAAAAAAAAA
AAAAACTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan