ESTScan Details for Unigene SGN-U328213

Score 
323
Direction 
Forward
Predicted Peptide Sequence 
MMLSRISRSISKASRSSIHKGVGYGVRSTVLDEVATGGACITRVDGGLGFVRTYLTLIGGGRRGLSKELDSVLASPRLRRFFCSEGPKRR
NYENYYPKNKKEIPKANNNQKAESGKEEGSSEQGNPQENFIKLNYNLLAPLLFIGFILSSILMS
Predicted Coding Sequence 
ATGATGCTTTCACGTATTAGCCGCTCCATATCTAAGGCTTCTCGTTCCAGCATTCACAAAGGTGTTGGATATGGAGTGAGGTCGACGGTG
TTGGATGAAGTGGCAACCGGTGGCGCGTGCATTACACGCGTTGATGGTGGGTTAGGGTTTGTGAGAACGTATTTGACGTTGATTGGAGGT
GGAAGGAGAGGTTTGAGTAAGGAGCTTGATTCGGTTTTGGCAAGCCCTAGGCTTAGGAGGTTTTTCTGTAGCGAAGGGCCAAAGAGAAGA
AACTATGAGAACTATTATCCAAAGAACAAGAAAGAAATTCCCAAAGCAAATAATAATCAAAAGGCTGAGTCAGGCAAAGAGGAAGGTTCA
AGTGAGCAAGGAAATCCCCAAGAGAACTTCATTAAGCTAAACTACAATTTACTAGCACCCTTATTATTTATTGGGTTTATTCTGTCATCT
ATCCTCATGTCT
Edits in Original Sequence 
AAATTCTTCGACCTAAACAATAGCTCCAAATGCAAAAAATCTTATAAATCTGTGAAAATTAAACTGTTTTTTTTGCTAATTTCTCGTCGA
TATTATCTATCGATTTGCCTTAAAGGATCCGTTTTTCAGAATCGATTTCTAAGGATTTGAAAAGGAAATTCATGTTAAGGAAATCACCAA
AAAA
(5')ATGATGCTTTCACGTATTAGCCGCTCCATATCTAAGGCTTCTCGTTCCAGCATTCACAAAGGTGTTGGATATGGAGTGAGGT
CGACGGTGTTGGATGAAGTGGCAACCGGTGGCGCGTGCATTACACGCGTTGATGGTGGGTTAGGGTTTGTGAGAACGTATTTGACGTTGA
TTGGAGGTGGAAGGAGAGGTTTGAGTAAGGAGCTTGATTCGGTTTTGGCAAGCCCTAGGCTTAGGAGGTTTTTCTGTAGCGAAGGGCCAA
AGAGAAGAAACTATGAGAACTATTATCCAAAGAACAAGAAAGAAATTCCCAAAGCAAATAATAATCAAAAGGCTGAGTCAGGCAAAGAGG
AAGGTTCAAGTGAGCAAGGAAATCCCCAAGAGAACTTCATTAAGCTAAACTACAATTTACTAGCACCCTTATTATTTATTGGGTTTATTC
TGTCATCTATCCTCATGTCT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan