ESTScan Details for Unigene SGN-U328279

Score 
405
Direction 
Forward
Predicted Peptide Sequence 
MGIGILGSFLLLTVFFRPLLCQQPNTDGFFVSDFLQKMGVTKVHNFSAHFCSWQGVGCDSKDENVVNLTAKSFGLSGVVPETPFGKLTKL
KYLDX
Predicted Coding Sequence 
ATGGGAATAGGCATTCTTGGTTCTTTTCTGCTTTTGACTGTGTTCTTTAGGCCTTTGCTTTGTCAACAGCCAAATACTGATGGATTTTTT
GTGTCTGATTTTCTTCAAAAGATGGGGGTTACTAAAGTTCACAACTTTTCAGCTCACTTTTGTTCTTGGCAAGGGGTTGGATGTGATTCC
AAGGATGAAAATGTTGTTAATTTGACAGCTAAAAGTTTTGGTTTATCTGGTGTTGTTCCTGAAACACCATTTGGTAAACTCACAAAGCTT
AAGTATTTGGATCXX
Edits in Original Sequence 
CTTTTTTCATGCAGAGGTCAGACAAGGTAAGTGCACATGATTCATTCTTTCTTCCAGAAACCCCAAAAATCTTAGTTGTCCTCTGAAATT
CCATTAACTTCTGAGGTGCTGTTTTTCATTTTTCTAAAGAAAGATTGGATTTTTATGCATTTTGAGCCTATTGTGTGTACTTCTTGAACT
TTTGGCTTTGTGGGGTTGTGCTGAAAGTGTATGTTTTGGTTATTCTTGGAAAGTAGAACAACTTTATGTGTCAAAAATGGTGTTGAAGTT
CTGAAAAAAGGGAGGTTTTTAAGGGGATTTTTTTGCTTCTTTCTTTTTTTCTCTGAGTTTTACAGTTGAAGTTTATCTTTCTCATTTCTC
ACAGAAAGATTTGATTTTTATGTATTTTTATTCAGTAGTGTACTCTTCTTGAACTTTTGGCTTTGTGGGGCTGTGGTATAAATGGTGTTG
GAGTTCAGAAAAAGGTAGATTTTTGGAGGGGTTTGCTTCTTTCTTTTATTACACTCTTGAGTTTATAGTTGAAGCCTTATCTACAA
(5')
ATGGGAATAGGCATTCTTGGTTCTTTTCTGCTTTTGACTGTGTTCTTTAGGCCTTTGCTTTGTCAACAGCCAAATACTGATGGATTTTTT
GTGTCTGATTTTCTTCAAAAGATGGGGGTTACTAAAGTTCACAACTTTTCAGCTCACTTTTGTTCTTGGCAAGGGGTTGGATGTGATTCC
AAGGATGAAAATGTTGTTAATTTGACAGCTAAAAGTTTTGGTTTATCTGGTGTTGTTCCTGAtAACACCATTTGGTAAACTCACAAAGCT
TAAGTATTTGGATCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan