ESTScan Details for Unigene SGN-U328280

Score 
263
Direction 
Forward
Predicted Peptide Sequence 
ELLFMKRGGELIYAGPLGGRSCKLIEYFEAIEGVPPIRPGYNPATWMLEVTSSVEETRLGVDFAEIYHRSNLFQYNQVLVERLSRSRGDS
KDLNFPAKYCQSYFSQFLACLWKQNLSYWRNPQYTAVXLLLYAHHIFDAWDNLLQIRX
Predicted Coding Sequence 
XATGAGCTTTTGTTTATGAAGCGTGGAGGAGAGCTCATTTATGCCGGACCTCTTGGGGGGAGATCTTGCAAGTTGATAGAGTATTTTGAG
GCAATTGAAGGAGTACCCCCAATAAGACCTGGATATAATCCAGCTACATGGATGTTGGAGGTTACTTCGTCAGTAGAAGAAACTCGACTT
GGTGTTGATTTTGCAGAAATTTACCACAGATCAAACCTTTTTCAATATAATCAAGTTTTGGTTGAAAGGCTAAGCAGGTCACGTGGCGAT
TCGAAAGATTTGAATTTCCCTGCTAAGTATTGTCAGTCCTATTTCAGTCAGTTCCTAGCTTGCCTTTGGAAGCAAAATCTCTCATATTGG
CGCAATCCACAATATACTGCTGTTCXGCTTCTTCTATACGCTCATCATATCTTTGATGCTTGGGACAATTTGTTGCAGATTCGGATX
Edits in Original Sequence 
(5')XATGAGCTTTTGTTTATGAAGCGTGGAGGAGAGCTCATTTATGCCGGACCTCTTGGGGGGAGATCTTGCAAGTTGATAGAGTATTT
TGAGGCAATTGAAGGAGTACCCCCAATAAGACCTGGATATAATCCAGCTACATGGATGTTGGAGGTTACTTCGTCAGTAGAAGAAACTCG
ACTTGGTGTTGATTTTGCAGAAATTTACCACAGATCAAACCTTTTTCAATATAATCAAGTTTTGGTTGAAAGGCTAAGCAGGTCACGTGG
CGATTCGAAAGATTTGAATTTCCCTGCTAAGTATTGTCAGTCCTATTTCAGTCAGTTCCTAGCTTGCCTTTGGAAGCAAAATCTCTCATA
TTGGCGCAATCCACAATATACTGCTGTTCXGCTTCTTCTATACGCTCATCATATCTTTGATGCTTGGGACAATTTGTTGCAGATTCGGAT
X(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan