ESTScan Details for Unigene SGN-U328575

Score 
1964
Direction 
Forward
Predicted Peptide Sequence 
WFKMELTNSRGTSLREKIIRGSSLRGSLSRKRNSTNNSRWNGNDGEIFNRSTRDEDDEEALKWAALEKLPTFDRLRKGLLFGSQGASAEI
DIHDIGFQERNKLLERLVKVADEDNEKLLLKLKQRIDRVGIDLPEIEVRYEHLTIEADAYVGSRALPTFINFISNFFEDILNSXPYPTES
KEETNFLNDVSGIIKPRRLTLLLGPPSSGKTTLLLALAGKLDSALKVTGKVTYNGHEMNEFVPQRTAAYISQYDLHIGEMTVRETLEFSA
RCQGVGSSYEMLVELSRREKAAKIKPDPDIDIFMKALATEGQEAVFVTDYVLKLLGLDICADTMVGDEMIRGISGGQKKRVTTGEMLVGP
SKALFMDEISTGLDSSTTYSIVNSLRQSVQILHGTAVISLLQPAPETYNLFDDIILLSDEKIVYQGPREDVLGFFESMGFKCPDRKGVAD
FLQEVTSKKDQQQYWVRRDETYRFITSKEFAEAHQSFHVGRKLADKLAASYDKSKSHPAALSTQKYGIGKKQLLKVCTERELLLMKRNSF
VYIFKFIQLTIVALISMTLFFRTKMPRDTTEDGVKYVGALFLVVTQIMFNGMAEIALTIYKLPVFYKQRDLLFYPSWAYAMPTWILKMPI
TFAEVGLWVFLTYYVIGFDPSAAKIIQTVFATHITKPDGVSIVSFIGAAGRTMGVANTFGTFVLLLQFALGGFVLSRVDVKKWWLWGYWS
SPMMYAMNSILVNEFDGKKWKQIAPNGTDSLGVTX
Predicted Coding Sequence 
XTTTGGTTCAAAATGGAGCTAACTAATTCAAGAGGTACTAGTTTAAGAGAAAAAATAATCAGGGGAAGTAGTTTGAGAGGGAGCTTAAGT
AGAAAGAGGAATAGTACTAACAACTCCAGGTGGAATGGCAATGATGGGGAGATTTTTAATCGTTCAACGAGAGACGAAGATGATGAAGAG
GCTCTTAAATGGGCAGCTCTTGAAAAACTTCCAACGTTTGATCGTTTGAGAAAAGGTCTCTTGTTTGGATCACAAGGTGCATCTGCTGAA
ATTGATATACATGATATTGGTTTTCAAGAAAGAAACAAGTTGCTTGAAAGGCTTGTCAAAGTTGCAGATGAGGATAATGAGAAGCTCCTG
TTGAAACTCAAGCAAAGAATTGACAGAGTTGGGATAGATTTGCCTGAAATAGAAGTAAGATATGAGCATTTAACTATTGAGGCAGATGCA
TATGTAGGAAGTAGAGCTTTGCCTACATTTATCAACTTTATCTCTAATTTTTTTGAGGATATATTGAACTCTGXTCCATATCCTACCGAG
TCGAAAGAGGAAACTAACTTTCTTAATGATGTGAGTGGTATCATTAAGCCTCGCAGATTGACTTTGCTTTTAGGACCTCCAAGTTCCGGG
AAAACTACATTATTATTAGCTTTGGCCGGAAAGCTCGACTCTGCCCTTAAGGTTACTGGAAAAGTGACCTATAATGGACATGAAATGAAT
GAGTTTGTGCCGCAAAGAACAGCTGCTTATATTAGCCAGTATGATTTACATATTGGAGAAATGACTGTGAGAGAAACCTTGGAATTCTCC
GCCAGATGCCAGGGAGTTGGATCGAGTTATGAGATGTTGGTTGAACTGTCAAGAAGAGAGAAAGCAGCTAAAATCAAGCCAGATCCTGAT
ATTGATATTTTCATGAAGGCATTAGCAACAGAGGGACAAGAAGCCGTTTTTGTTACAGATTATGTTCTGAAGCTTTTGGGGCTGGATATT
TGTGCAGATACTATGGTGGGAGATGAAATGATTAGGGGAATTTCAGGAGGACAAAAGAAGCGTGTGACAACCGGTGAAATGCTCGTTGGA
CCGTCCAAGGCACTTTTCATGGATGAAATCTCAACTGGATTGGATAGTTCTACTACTTACTCAATAGTGAACTCACTAAGACAATCTGTG
CAAATCTTGCACGGAACTGCTGTGATATCTCTCTTGCAGCCAGCACCCGAGACGTACAACTTGTTCGACGACATTATTCTGTTATCAGAT
GAGAAAATTGTCTATCAGGGACCTCGAGAGGATGTCCTTGGCTTCTTTGAGTCCATGGGGTTCAAATGTCCAGACAGAAAAGGCGTGGCC
GACTTCTTGCAAGAAGTGACTTCAAAGAAAGATCAACAGCAATATTGGGTGAGGAGGGATGAAACTTACCGGTTTATCACTTCAAAAGAA
TTTGCTGAGGCACATCAATCGTTCCATGTTGGGAGGAAACTCGCGGATAAGCTTGCAGCTTCATATGACAAGAGCAAAAGCCATCCTGCT
GCTTTGTCAACTCAAAAGTATGGTATAGGGAAGAAACAACTCTTAAAGGTCTGCACTGAACGAGAACTCTTACTAATGAAGAGGAACTCA
TTTGTTTACATCTTCAAGTTCATTCAGCTTACAATTGTGGCACTCATATCAATGACTCTCTTTTTCCGTACTAAGATGCCGCGTGATACA
ACTGAAGATGGAGTAAAATATGTTGGTGCCCTCTTTTTGGTTGTCACTCAGATTATGTTTAACGGAATGGCTGAGATCGCCCTGACAATT
TACAAACTTCCTGTCTTCTACAAGCAAAGGGACCTTCTCTTTTACCCTTCATGGGCTTATGCAATGCCCACATGGATACTCAAAATGCCT
ATAACATTTGCTGAAGTTGGACTTTGGGTGTTCCTCACTTACTATGTCATAGGATTTGATCCGAGTGCTGCXAAGATTATTCAAACAGTT
TTTGCTACTCATATTACTAAACCAGATGGCGTCAGCATTGTTTCCTTCATTGGGGCAGCTGGAAGGACCATGGGAGTTGCTAATACATTT
GGAACATTTGTTCTGCTTTTACAGTTTGCATTGGGTGGATTCGTTCTTTCACGAGTTGATGTGAAGAAATGGTGGTTATGGGGTTACTGG
TCATCACCGATGATGTATGCTATGAATTCAATTCTTGTGAATGAATTTGATGGAAAAAAGTGGAAACAAATTGCACCAAATGGAACTGAT
TCACTTGGAGTTACAGXX
Edits in Original Sequence 
(5')XTTTGGTTCAAAATGGAGCTAACTAATTCAAGAGGTACTAGTTTAAGAGAAAAAATAATCAGGGGAAGTAGTTTGAGAGGGAGCTT
AAGTAGAAAGAGGAATAGTACTAACAACTCCAGGTGGAATGGCAATGATGGGGAGATTTTTAATCGTTCAACGAGAGACGAAGATGATGA
AGAGGCTCTTAAATGGGCAGCTCTTGAAAAACTTCCAACGTTTGATCGTTTGAGAAAAGGTCTCTTGTTTGGATCACAAGGTGCATCTGC
TGAAATTGATATACATGATATTGGTTTTCAAGAAAGAAACAAGTTGCTTGAAAGGCTTGTCAAAGTTGCAGATGAGGATAATGAGAAGCT
CCTGTTGAAACTCAAGCAAAGAATTGACAGAGTTGGGATAGATTTGCCTGAAATAGAAGTAAGATATGAGCATTTAACTATTGAGGCAGA
TGCATATGTAGGAAGTAGAGCTTTGCCTACATTTATCAACTTTATCTCTAATTTTTTTGAGGATATATTGAACTCTGXTCCATATCCTAC
CGAGTCGAAAGAGGAAACTAACTaTTCTTAATGATGTGAGTGGTATCATTAAGCCTCGCAGATTGACTTTGCTTTTAGGACCTCCAAGTT
CCGGGAAAACTACATTATTATTAGCTTTGGCCGGAAAGCTCGACTCTGCCCTTAAGGTTACTGGAAAAGTGACCTATAATGGACATGAAA
TGAATGAGTTTGTGCCGCAAAGAACAGCTGCTTATATTAGCCAGTATGATTTACATATTGGAGAAATGACTGTGAGAGAAACCTTGGAAT
TCTCCGCCAGATGCCAGGGAGTTGGATCGAGTTATGAGATGTTGGTTGAACTGTCAAGAAGAGAGAAAGCAGCTAAAATCAAGCCAGATC
CTGATATTGATATTTTCATGAAGGCATTAGCAACAGAGGGACAAGAAGCCGTTTTTGTTACAGATTATGTTCTGAAGCTTTTGGGGCTGG
ATATTTGTGCAGATACTATGGTGGGAGATGAAATGATTAGGGGAATTTCAGGAGGACAAAAGAAGCGTGTGACAACCGGTGAAATGCTCG
TTGGACCGTCCAAGGCACTTTTCATGGATGAAATCTCAACTGGATTGGATAGTTCTACTACTTACTCAATAGTGAACTCACTAAGACAAT
CTGTGCAAATCTTGCACGGAACTGCTGTGATATCTCTCTTGCAGCCAGCACCCGAGACGTACAACTTGTTCGACGACATTATTCTGTTAT
CAGATGAGAAAATTGTCTATCAGGGACCTCGAGAGGATGTCCTTGGCTTCTTTGAGTCCATGGGGTTCAAATGTCCAGACAGAAAAGGCG
TGGCCGACTTCTTGCAAGAAGTGACTTCAAAGAAAGATCAACAGCAATATTGGGTGAGGAGGGATGAAACTTACCGGTTTATCACTTCAA
AAGAATTTGCTGAGGCACATCAATCGTTCCATGTTGGGAGGAAACTCGCGGATAAGCTTGCAGCTTCATATGACAAGAGCAAAAGCCATC
CTGCTGCTTTGTCAACTCAAAAGTATGGTATAGGGAAGAAACAACTCTTAAAGGTCTGCACTGAACGAGAACTCTTACTAATGAAGAGGA
ACTCATTTGTTTACATCTTCAAGTTCATTCAGCTTACAATTGTGGCACTCATATCAATGACTCTCTTTTTCCGTACTAAGATGCCGCGTG
ATACAACTGAAGATGGAGTAAAATATGTTGGTGCCCTCTTTTTGGTTGTCACTCAGATTATGTTTAACGGAATGGCTGAGATCGCCCTGA
CAATTTACAAACTTCCTGTCTTCTACAAGCAAAGGGACCTTCTCTTTTACCCTTCATGGGCTTATGCAATGCCCACATGGATACTCAAAA
TGCCTATAACATTTGCTGAAGTTGGACTTTGGGTGTTCCTCACTTACTATGTCATAGGATTTGATCCGAGTGCTGCXAAGATTATTCAAA
CAGTTTTTGCTACTCATATTACTAAACCAGATGGCGTCAGCATTGTTTCgCTTCATTGGGGCAGCTGGAAGGACCATGGGAGTTGCTAAT
ACATTTGGAACATTTGTTCTGCTTTTACAGTTTGCATTGGGTGGATTCGTTCTTTCACGAGTTGATGTGAAGAAATGGTGGTTATGGGGT
TACTGGTCATCACCGATGATGTATGCTATGAATTCAATTCTTGTGAATGAATTTGATGGAAAAAAGTGGAAACAAATTGCACCAAATGGA
ACTGATTCACTTGGAGTTACAGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan