ESTScan Details for Unigene SGN-U328685

Score 
455
Direction 
Forward
Predicted Peptide Sequence 
MEESLLPGESSSNSWGRIRNRRRVGSMFDPRDAIAHGSAYQKAAALVDLAEDGVGLPEEILEGTSFEKAAQLYFMFTRFDFLWSLNYLAL
VLINFFEKPLWCSRHLAESCNNRDYYYLGQLPFLTGAESLIYEGVTLLLLVIHILFPISYEGLPSLLEKSSQQTEGRFAVNLGCGYX
Predicted Coding Sequence 
ATGGAAGAATCTCTGTTGCCCGGAGAGAGTAGCAGCAACAGTTGGGGACGGATTCGGAATCGGAGGAGGGTTGGTTCCATGTTTGATCCC
AGAGATGCTATTGCTCATGGATCTGCTTATCAAAAAGCTGCTGCTTTAGTTGATCTTGCTGAAGATGGCGTTGGTCTACCTGAGGAAATT
CTTGAGGGAACGAGCTTTGAAAAGGCAGCACAATTGTACTTCATGTTTACTCGTTTTGACTTCCTCTGGTCACTTAATTATCTTGCACTA
GTACTTATAAACTTCTTTGAGAAACCATTGTGGTGCTCCAGGCATTTAGCTGAGTCATGCAATAATAGAGACTACTACTATCTAGGACAG
CTGCCATTTTTGACTGGTGCTGAGTCCCTTATATATGAGGGTGTTACTCTTCTTCTTCTTGTAATACACATTTTATTTCCAATATCATAT
GAAGGXCTTCCATCTCTACTGGAGAAGTCTTCTCAACAGACTGAAGGTCGNTTTGCTGTTAATCTTGGTTGCGGATATTXX
Edits in Original Sequence 
CTGGGAAGTATATAAAAGATGTATCTTAACTGAACATCAACGACCCTTTTGTCTACTCCATTAACTCTTCTTCTTCTTGTTATTTCTGCT
TCAGTTTCAACT
(5')ATGGAAGAATCTCTGTTGCCCGGAGAGAGTAGCAGCAACAGTTGGGGACGGATTCGGAATCGGAGGAGGGTTGG
TTCCATGTTTGATCCCAGAGATGCTATTGCTCATGGATCTGCTTATCAAAAAGCTGCTGCTTTAGTTGATCTTGCTGAAGATGGCGTTGG
TCTACCTGAGGAAATTCTTGAGGGAACGAGCTTTGAAAAGGCAGCACAATTGTACTTCATGTTTACTCGTTTTGACTTCCTCTGGTCACT
TAATTATCTTGCACTAGTACTTATAAACTTCTTTGAGAAACCATTGTGGTGCTCCAGGCATTTAGCTGAGTCATGCAATAATAGAGACTA
CTACTATCTAGGACAGCTGCCATTTTTGACTGGTGCTGAGTCCCTTATATATGAGGGTGTTACTCTTCTTCTTCTTGTAATACACATTTT
ATTTCCAATATCATATGAAGGXCTTCCATCTCTACTGGAGAAGTCTTCTCAACAGACTGAAGGTCGNTTTGCTGTTAATCTTGGTTGCGG
ATATTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan