ESTScan Details for Unigene SGN-U328779

Score 
154
Direction 
Forward
Predicted Peptide Sequence 
FPRTLXKIMAVKDKKPSVEINNLKFTYPGIDGHPPPGSTPLIDDFNLTLYPGDRCLLVGSNGAGSNSISIPHIENLNYSL
Predicted Coding Sequence 
TTTCCTCGAACACTTGAXAAGATTATGGCGGTAAAGGACAAAAAGCCATCAGTAGAGATCAACAATCTCAAGTTCACCTATCCTGGTATA
GATGGACATCCGCCTCCCGGATCTACCCCTTTGATAGATGATTTCAACCTTACCCTTTATCCTGGTGATCGATGCCTTCTTGTCGGATCT
AATGGCGCAGGTTCTAATTCTATTTCCATTCCACACATTGAAAATCTGAATTACTCTCTTTAG
Edits in Original Sequence 
(5')TTTCCTCGAACACTTGAXAAGATTATGGCGGTAAAGGACAAAAAGCCATCAGTAGAGATCAACAATCTCAAGTTCACCTATCCTGG
TATAGATGGACATCCGCCTCCCGGATCTACCCCTTTGATAGATGATTTCAACCTTACCCTTTATCCTGGTGATCGATGCCTTCTTGTCGG
ATCTAATGGCGCAGGTTCTAATTCTATTTCCATTCCACACATTGAAAATCTGAATTACTCTCTTTAG(3')TATAATCAAGAATTCTAAA
GGGGTTGTATTAAACTTGTTTCTCGATCCTGCTATCCCCAATTCCGAATTTTTAGGGTGCCTTTTGGTGTTGACGAAATTGTCTTTTCGT
GGAAAAGAAGTTGTTTTCTTAATGATGTTTCCACCATTTGATAAGATATAGAAGGTGTGCTAACCCAGGGTAATTGTATAATGTACAAGA
TAAGGTACAAGGATAGTGTTTTGACATATTCTTTTTTAGTGTTAAAGGTTGACAACAATGTTTAGATGTCTGTTGTGGTGAGTAAGAATT
GTCATATTTGTACAGAAAAATGACTTGCCTTCATAAAGGGAGAGGATGCCATCTTGCTTATTTTGCTAGAAAATTGTAGAAAACATAGCC
AACCAAACACTGTATATACATTTTTTGCCCTACCAAAGGCATTCCCTTAATAAGAGGTTTGATTGAGATCTGAGAGACATGTTCTTTTGA
TAGGGAAGACTACAATCCTGAAGATATTGGGAGGAAAGCATATGGTAGAACCAGACATGGTCAGAGTCCTTGGAAGATCTGCATTTCATG
ACACTGCTTTGACGGCTTCTGGAGACCTCAGTTATCTTGGTGGAGAGGTGTCTCTTCTCTTGCTTTGCTCCTTCACTATCTCTTCATAGN
TTATTATATTTTGAGGACTGTCACCTTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan