ESTScan Details for Unigene SGN-U328970

Score 
280
Direction 
Forward
Predicted Peptide Sequence 
LTPLKISFSDGSIPNTTGRKYFPFFSTQPSFFHSRFQXPESHFPEGIIEXAAVYAAAVAEAPPELQRRTPASLYDVLRVKSNASPKEIKT
AYRNLAKLYHPDAASLSEESSDGRHFIEIHEAYATLSDPVSRDLYDLKLNMSSGDEVLGAPAMEFVGMGQSFTRPEGGKRISVGDVR
Predicted Coding Sequence 
XTTCTCACTCCACTGAAAATATCATTTTCCGATGGTTCAATCCCTAACACTACCGGCCGGAAATACTTTCCGTTTTTCTCTACACAACCT
TCCTTCTTCCACAGCCGGTTTCAGATXCCGGAGTCACATTTCCCCGAAGGAATAATCGAAXCAGCAGCGGTATATGCCGCCGCCGTTGCG
GAAGCACCGCCGGAATTGCAAAGGAGAACACCGGCGAGTCTCTACGATGTACTAAGGGTAAAATCAAATGCGTCACCCAAAGAGATAAAA
ACAGCTTACCGGAATTTAGCTAAGCTATACCATCCCGATGCTGCGTCTCTGTCGGAGGAATCTTCCGACGGACGGCATTTCATTGAGATT
CACGAAGCTTATGCTACGTTATCAGATCCTGTTTCTAGAGATCTCTATGATCTCAAGCTAAACATGAGCTCCGGCGACGAGGTTTTGGGA
GCTCCGGCGATGGAATTCGTAGGAATGGGTCAGAGTTTTACCCGACCCGAAGGTGGGAAACGGATCAGTGTTGGTGACGTCAGATGA
Edits in Original Sequence 
(5')XTTCTCACTCCACTGAAAATATCATTTTCCGATGGTTCAATCCCTAACACTACCGGCCGGAAATACTTTCCGTTTTTCTCTACACA
ACCTTCCTTCTTCCACAGCCGGTTTCAGATXCCGGAGTCACATTTCCCCGAAGGAATAATCGAAXCAGCAGCGGTATATGCCGCCGCCGT
TGCGGAAGCACCGCCGGAATTGCAAAGGAGAACACCGGCGAGTCTCTACGATGTACTAAGGGTAAAATCAAATGCGTCACCCAAAGAGAT
AAAAACAGCTTACCGGAATTTAGCTAAGCTATACCATCCCGATGCTGCGTCTCTGTCGGAGGAATCTTCCGACGGACGGCATTTCATTGA
GATTCACGAAGCTTATGCTACGTTATCAGATCCTGTTTCTAGAGATCTCTATGATCTCAAGCTAAACATGAGCTCCGGcCGACGAGGTTT
TGGGAGCTCCGGCGATGGAATTCGTAGGAATGGGTCAGAGTTTTACCCGACCCGAAGGTGGGAAACGGATCAGTGTTGGTGACGTCAGAT
GA(3')TTAGGATTTAGGGGACCCACTTTGCCGCGTTAACACTGTATATATCCTGTAATTTTTTTTCAATGGAATTTAAAAAAAAACAGG
TCTTGTTTGAGGAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan