ESTScan Details for Unigene SGN-U329058

Score 
307
Direction 
Forward
Predicted Peptide Sequence 
MTVQKAFVAMLIASFLLVHFANAQKVDYSKPPASAPQGPQPLDCKELVNIGAVSRPGKIYATEHVEAAAIDATXVPPGTSGNYESCPCYF
NLTTHNTTRKCP
Predicted Coding Sequence 
ATGACGGTCCAAAAGGCATTCGTTGCAATGCTTATTGCATCCTTTCTACTAGTCCATTTCGCTAATGCTCAAAAGGTTGACTACAGCAAG
CCACCAGCATCAGCCCCTCAAGGTCCACAGCCACTAGATTGCAAGGAGCTTGTAAATATCGGTGCAGTGAGTCGTCCAGGCAAAATCTAT
GCAACAGAGCATGTGGAAGCTGCTGCCATAGATGCCACTGXTGTGCCACCAGGGACTTCTGGAAATTATGAATCATGCCCTTGCTATTTC
AATCTTACGACTCATAACACCACCCGCAAATGCCCTTAA
Edits in Original Sequence 
AGAAGGCTTGCTCAGTTCTTAAGAGCTCTCTGTTTTCTCCTTCCTTCGTGTATACACACACCATTTTGTGTTTTTGTTTTTGAAACA(5')
ATGACGGTCCAAAAGGCATTCGTTGCAATGCTTATTGCATCCTTTCTACTAGTCCATTTCGCTAATGCTCAAAAGGTTGACTACAGCAA
GCCACCAGCATCAGCCCCTCAAGGTCCACAGCCACTAGATTGCAtAGGAGCTTGTAAATATCGGTGCAGTGAGTCGTCCAGGCAAAATCT
ATGCAACAGAGCATGTGGAAGCTGCTGCCATAGATGCCACTGXTGTGCCACCAGGGACTTCTGGAAATTATGAATCATGCCCTTGCTATT
TCAATCTTACGACTCATAACACCACCCGCAAATGCCCTTAA(3')TCCCTTTTTCTTAGTTTTTAAATTTGTTCCCCAAAGGAAGTCCAT
TTTCAAAAAAAAAAACAGAGTGTAACTTTCAATTCAATTCAATGTTCCTTCTGTTTACGAAGCTTGTGATGATGCAATAATACATAAGTA
TTTATAACTTTGTTCATAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan